Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wnoA_

Fold library idPDB HeaderMoleculeTitle
c5wnoA_2.39PDB header: transferaseChain: A: PDB Molecule: receptor tyrosine-protein kinase let-23;


Added to library: Sat Feb 3 09:30:00 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CLIPSSELQTKLDKKLGAGAFGTVFAGIYYPKRANVKIPVAIKVFQTDQSQTDEMLEEATNMFRLRHDNL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
B

GGG

SS


S






TT

ST


TTB
 .........80.........90.........100.........110.........120.........130.........140
Sequence LKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNV
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


SS


TT
BTTTT

TT


S

SGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence LVKKFNHVEITDFGLSKILKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHN
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) TT
S
S
TTT

GGGGG

S



TTS

TTTT

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence FLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFLENSNKISESDLSAEER
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT





TTB
TT
SSTTTS

TTSGGGTB






 .........290.........300..
Sequence FQTERIREMFDGNIDPQMYFDQ
Predicted secondary structure









SS confidence





















Known secondary structure (DSSP) TTT
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D