Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wk4E_

Fold library idPDB HeaderMoleculeTitle
c5wk4E_1.50PDB header: immune systemChain: E: PDB Molecule: variable lymphocyte receptor 39;


Added to library: Sat Dec 16 08:49:22 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CPSQCSCRGTTVNCDSRSLASVPAGIPTDRQNLWLNNNQITKLEPGVFDSLTALTFLNVGDNQLSALPIG
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)

TTSTT

SS

SS

S


SS
S

SS





TTTTTT
TT
S

SS





TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VFDRLAQLTRLGLSHNQFTALPAGVFDKLPKLTHLVLHTNQLKSIPRGAFDNLKSLTHIYLFNNPWDCEC
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) TTTT
TT



SS

S


TTTTTT
TT



SS

S


TTTTTT
TT
S

SS
B
TTB
 .........150.........160.........170.........180.........190.
Sequence SDILYLKNWIVQHASIVNPHPYGGVDNVKCSGTNTPVRAVTEASTSPSKCP
Predicted secondary structure






























SS confidence


















































Known secondary structure (DSSP) TTTGGGBS
TTS

GGGSBBTTT

BGGG

GGG
BGGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D