Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wk4E_

Fold library idPDB HeaderMoleculeTitle
c5wk4E_1.50PDB header: immune systemChain: E: PDB Molecule: variable lymphocyte receptor 39;


Added to library: Sat Dec 16 08:49:22 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CPSQCSCRGTTVNCDSRSLASVPAGIPTDRQNLWLNNNQITKLEPGVFDSLTALTFLNVGDNQLSALPIG
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)

TTSTT

SS

SS

S


SS
S

SS





TTTTTT
TT
S

SS





TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VFDRLAQLTRLGLSHNQFTALPAGVFDKLPKLTHLVLHTNQLKSIPRGAFDNLKSLTHIYLFNNPWDCEC
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) TTTT
TT



SS

S


TTTTTT
TT



SS

S


TTTTTT
TT
S

SS
B
TTB
 .........150.........160.........170.........180.........190.
Sequence SDILYLKNWIVQHASIVNPHPYGGVDNVKCSGTNTPVRAVTEASTSPSKCP
Predicted secondary structure






























SS confidence


















































Known secondary structure (DSSP) TTTGGGBS
TTS

GGGSBBTTT

BGGG

GGG
BGGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D