Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wk1C_

Fold library idPDB HeaderMoleculeTitle
c5wk1C_3.60PDB header: virusChain: C: PDB Molecule: major capsid protein;


Added to library: Sat Jan 20 10:37:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MQRVDEMYRLVDSTGTGEDRDWGNQTLLGRLLSQAQTVSIGKKVIESRRYSEAGRINRSMSGQTDIDMDK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


STTTT












SS
STTS


TT










SSS
S





 .........80.........90.........100.........110.........120.........130.........140
Sequence TKSSYQKMVIPVFDGAYGRDFRDYEAMRSEMLPALAEDSEEIEFTLLDDVNDYLWNGDAKLKVDTAVWGG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)




TT


SS

TT

SSS




 .........150.........160.........170.........180.........190.........200.........210
Sequence LKADASVAAYSLGADLTTATEAQVVAELLALLDVLRITNKKSGPFELYISPQIMSNWQKLAGANTNGFMN
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTT
TTS


S
TTT

STTTTTTTSS


S


TTTTS

SS

SS


 .........220.........230.........240.........250.........260.........270.........280
Sequence IMAAVRALIPEFSVVEADSALQGNQVLCSVVGTRGLHAKIGMMMSSYQVPRVMHNDPYQFVKWFAAGFQS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SGGGTTTT



S

TTS
SS

BSTTSB



SSS


 .........290....
Sequence NNSFSGLKSTVYGS
Predicted secondary structure





SS confidence













Known secondary structure (DSSP)


TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D