Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wk0A_

Fold library idPDB HeaderMoleculeTitle
c5wk0A_1.34PDB header: unknown functionChain: A: PDB Molecule: damage-inducible protein dinb;


Added to library: Sat Feb 24 08:30:36 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MTTKTVFDVIDMGLGYLVNVYDAWKVEKVLDDYHKPFSNTIHWQFGHVLTIFESALAVAGKENIDLNIYR
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

S

TTGGGGTT


TT
SS
GGGT


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence PLFGNGSSPDEWKDEVPSIERILEGLQTLPERARNLTEDDLAIELKQPIVGCNNLEELLVLNAIHIPLHA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) STT

GGG

S



T

T
B
SS
SSS

B
 .........150......
Sequence GKIEEMSRILKNLKAL
Predicted secondary structure

SS confidence















Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D