Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wiwA_

Fold library idPDB HeaderMoleculeTitle
c5wiwA_2.30PDB header: immune systemChain: A: PDB Molecule: tumor necrosis factor receptor superfamily member 9;


Added to library: Sat Dec 23 08:26:34 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CPPSTFNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGT
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP)

SS










TT


SSS


TTSTT




TTTT

TT
 .........80.........90.........100.........
Sequence FNDQAGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPLV
Predicted secondary structure






























SS confidence






































Known secondary structure (DSSP)

SSSS





TTTTT


SSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D