Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5whqA_

Fold library idPDB HeaderMoleculeTitle
c5whqA_2.90PDB header: oxidoreductaseChain: A: PDB Molecule: catalase-peroxidase;


Added to library: Sat Jan 20 10:25:03 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RKSNVGGGGTRNHDWWPAQLRLNILRQHTPVSNPLDKDFDYAAAFKSLDYEGLKKDLTKLMTDSQDWWPA
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


SSTT
S


TTS


GGGS
S
GGG

S
TT

TS



SSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence DFGHYGGLFIRMAWHSAGTYRVTDGRGGGGEGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGNKISWSD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) GGG

TT

TTT


SSTT
GGGSTTTTS
TT
TTTTSGGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LLLLTGNVALESMGFKTFGFAGGRPDTWEADESVYWGAETTWLGNEDRYSHNRDLQSPLASSHMGLIYVN
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) TTT










S

TT



S

STT

TTT







TT


SSTT
SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PEGPDGIPDPVASAKDIRVTFGRMAMNDEETVALIAGGHSFGKTHGAGPTHHVGKEPEAAPIEHQGLGWA
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) SS
GGG


TT

TS



B
S
GGG



TTTS
GGGTT



 .........290.........300.........310.........320.........330.........340.........350
Sequence NSFGQGKGPDTITSGLEVTWTPTPTKWGMGYLEYLYKFDWEPTKSPAGANQWVAKNAEPTIPDAYDPNKK
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)

STTSSGGG
BSSS





S
TTS
SSTTS

TTS
SS




SS
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence KLPTMLTTDIALRMDPAYDKICRDYLANPDKFADAFARAWFKLLHRDMGPRTRWIGPEVPSEILPWEDYI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


S
TTTTT
SGGG



S

TTS


 .........430.........440.........450.........460.........470.........480.........490
Sequence PPVDYQIIDDNDIAALKKEILATGVAPKKLIFVAWSSASSFRGSDKRGGANGARIRLAPQNEWKVNDPST
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)



S



T


T
BTTTTB
SSTBTGGGSTTGGG
GGG
 .........500.........510.........520.........530.........540.........550.........560
Sequence LREVLAALESVQQKFNDSSSGKKVSLADLIVLGGVAALEQASGLVVPFTPGRNDATQEHTDVHSFTHLEP
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) SS

S




S








B

GGG

GGGS
 .........570.........580.........590.........600.........610.........620.........630
Sequence HADGFRSYGKGTKRVRTEQFLIDRASLLTLSAPELTALIGGLRVLEANYDGSSYGVLTKTPGKLTNDYFV
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) S
BTTTTB



SS

TT

TT

GGG

BT


SSTTS

T
 .........640.........650.........660.........670.........680.........690.........700
Sequence NLLDTNTAWKAADNEGEVFIGYDRKTHDKKWTATRADLIFGAHAELRALAEVYAAVDGEEKFKRDFVAAW
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTSSTTS
TTT

SSSS
 .........710.
Sequence HKVMNLDRFDL
Predicted secondary structure





SS confidence










Known secondary structure (DSSP) TTT
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D