Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5whqA_

Fold library idPDB HeaderMoleculeTitle
c5whqA_2.90PDB header: oxidoreductaseChain: A: PDB Molecule: catalase-peroxidase;


Added to library: Sat Jan 20 10:25:03 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RKSNVGGGGTRNHDWWPAQLRLNILRQHTPVSNPLDKDFDYAAAFKSLDYEGLKKDLTKLMTDSQDWWPA
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


SSTT
S


TTS


GGGS
S
GGG

S
TT

TS



SSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence DFGHYGGLFIRMAWHSAGTYRVTDGRGGGGEGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGNKISWSD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) GGG

TT

TTT


SSTT
GGGSTTTTS
TT
TTTTSGGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LLLLTGNVALESMGFKTFGFAGGRPDTWEADESVYWGAETTWLGNEDRYSHNRDLQSPLASSHMGLIYVN
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) TTT










S

TT



S

STT

TTT







TT


SSTT
SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PEGPDGIPDPVASAKDIRVTFGRMAMNDEETVALIAGGHSFGKTHGAGPTHHVGKEPEAAPIEHQGLGWA
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) SS
GGG


TT

TS



B
S
GGG



TTTS
GGGTT



 .........290.........300.........310.........320.........330.........340.........350
Sequence NSFGQGKGPDTITSGLEVTWTPTPTKWGMGYLEYLYKFDWEPTKSPAGANQWVAKNAEPTIPDAYDPNKK
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)

STTSSGGG
BSSS





S
TTS
SSTTS

TTS
SS




SS
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence KLPTMLTTDIALRMDPAYDKICRDYLANPDKFADAFARAWFKLLHRDMGPRTRWIGPEVPSEILPWEDYI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


S
TTTTT
SGGG



S

TTS


 .........430.........440.........450.........460.........470.........480.........490
Sequence PPVDYQIIDDNDIAALKKEILATGVAPKKLIFVAWSSASSFRGSDKRGGANGARIRLAPQNEWKVNDPST
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)



S



T


T
BTTTTB
SSTBTGGGSTTGGG
GGG
 .........500.........510.........520.........530.........540.........550.........560
Sequence LREVLAALESVQQKFNDSSSGKKVSLADLIVLGGVAALEQASGLVVPFTPGRNDATQEHTDVHSFTHLEP
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) SS

S




S








B

GGG

GGGS
 .........570.........580.........590.........600.........610.........620.........630
Sequence HADGFRSYGKGTKRVRTEQFLIDRASLLTLSAPELTALIGGLRVLEANYDGSSYGVLTKTPGKLTNDYFV
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) S
BTTTTB



SS

TT

TT

GGG

BT


SSTTS

T
 .........640.........650.........660.........670.........680.........690.........700
Sequence NLLDTNTAWKAADNEGEVFIGYDRKTHDKKWTATRADLIFGAHAELRALAEVYAAVDGEEKFKRDFVAAW
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTSSTTS
TTT

SSSS
 .........710.
Sequence HKVMNLDRFDL
Predicted secondary structure





SS confidence










Known secondary structure (DSSP) TTT
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D