Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5we0J_

Fold library idPDB HeaderMoleculeTitle
c5we0J_2.30PDB header: gene regulationChain: J: PDB Molecule: protection of telomeres protein poz1;


Added to library: Sat Dec 23 09:10:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCHEKMPIFMDIAFIEYCFNLSLS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


SS





GGGTTS


TTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence QQILWEYSLISNALERLENIELERQNCMRELNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINF
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
SS





TSSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence TKFLQDWGSHNEKEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQLEVFCDYDFKQ
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) S


TTS
S
TSS


S
 ........
Sequence REIVKMLT
Predicted secondary structure
SS confidence







Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D