Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wddA_

Fold library idPDB HeaderMoleculeTitle
c5wddA_1.80PDB header: apoptosisChain: A: PDB Molecule: bcl-2-related ovarian killer protein;


Added to library: Sat Mar 3 08:35:09 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SPTDKELVSQAKALCRDYINSRLIRAGVSWSGKLAEVSAILLRLGDELEYIRPNVYRNIARQLNISLHSE
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)


T





TTTT

S

 .........80.........90.........100.........110.........120.........130.........140
Sequence TVVTDAFLAVAAQIFTAGITWGKVVSLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFVRKTLVTWLKRRG
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TT


TT
TTTTT
 .........150
Sequence GWADITKCVV
Predicted secondary structure

SS confidence









Known secondary structure (DSSP) SGGGGGGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D