Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wbiA_

Fold library idPDB HeaderMoleculeTitle
c5wbiA_3.00PDB header: protein bindingChain: A: PDB Molecule: regulatory-associated protein of tor 1;


Added to library: Sat Dec 23 09:19:24 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ATSMAYLPQTIVLCELRHDASEASAPLGTSEIVLVPKWRLKERMKTGCVALVLCLNITVDPPDVIKISPC
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)
GGGGGS




S
SGGG

SS

TTTTS






S








SS


SSS


SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence ARIEAWIDPFSMAPPKALETIGKNLSTQYERWQPRARYKVQLDPTVDEVRKLCLTCRKYAKTERVLFHYN
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)



SS

GGGGTTSSSSS


SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GHGVPKPTANGEIWVFNKSYTQYIPLPISELDSWLKTPSIYVFDCSAARMILNAFAELHDWGSSGSSGSS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S



TT

SSS
SS
SSSSS
TTS
S
SSSSSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence RDCILLAACDVHETLPQSVEFPADVFTSCLTTPIKMALKWFCRRSLLKEIIDESLIDRIPGRQNDRKTLL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) SSSS
TT





TTS
S
STTT
SSSS
TTTTTT
SS
SS
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence GELNWIFTAVTDTIAWNVLPHELFQRLFRQDLLVASLFRNFLLAERIMRSANCNPISHPMLPPTHQHHMW
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) S
S
TTT


SS




TT
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence DAWDMAAEICLSQLPQLVLDPSTEFQPSPFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLLSQCHRFR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S







TSS
SSSS

S
TT
TTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence ALVLLGRFLDMGSWAVDLALSVGIFPYVLKLLQTTTNELRQILVFIWTKILALDKSCQIDLVKDGGHTYF
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) T
T
GGG


GGGTT
TTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence IRFLDSSGAFPEQRAMAAFVLAVIVDGHRRGQEACLEANLIGVCLGHLEEPLFLQWLCLCLGKLWEDFME
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
SS

TT
TT


TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence AQIMGREANAFEKLAPLLSEPQPEVRAAAVFALGTLLDEFDDDEKIRAEDAIIKSLLDVVSDGSPLVRAE
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTGGGGSSS
T






TTT
S
 .........640.........650.........660.........670.........680.........690.........700
Sequence VAVALARFAFGHKQHLKLAAASYWAVYSQCVRAMFALAKDPSPRIASLGRRVLSIIGIEERSLLPLSTIY
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T

T
SSTT



SSS



 .........710.........720.........730.........740.........750.........760.........770
Sequence GWSCGHFSKPLSQEIAAKREEKEKFALEHIAKCQHSSISKLNNNPIANWDTRFETGTKTALLHPFSPIVV
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) GGGTTS


S




BSS
S




SS

SSSS
 .........780.........790.........800.........810.........820.........830.........840
Sequence AADENERIRVWNYEEATLLNGFDNHDFPDKGISKLCLINELDDSLLLVASCDGSVRIWKNYATKGKQKLV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT
TTTTS


SS


TTSS
TTSSTTSTT

 .........850.........860.........870.........880.........890.........900.........910
Sequence TGFSSIQLNAVVDWQQQSGYLYASGETSTVTLWDLEKEQLVRSVPSESECGVTALSASQVHGGQLAAGFA
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)





TTTTSSSSTTTT

SSS

SSSTTT
 .........920.........930.........940.........950.........960.........970.........980
Sequence DGSLRLYDVRSPEPLVCATRPHQKVERVVGLSFQPGLDPAKVVSASQAGDIQFLDLRTTRDTYLTIDAHR
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TS
TTSSS


S
S
S


B
SSSSS


TTSTTT
SS
S

S
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence GSLTALAVHRHAPIIASGSAKQLIKVFSLQGEQLGIIRYYPSFMAQKIGSVSCLTFHPYQVLLAAGAADS
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S

SSSSSSSTT




SSTT







SSSS
SSS
 ........
Sequence FVSIYTHD
Predicted secondary structure


SS confidence







Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D