Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5watB_

Fold library idPDB HeaderMoleculeTitle
c5watB_2.14PDB header: transferaseChain: B: PDB Molecule: homoserine kinase;


Added to library: Sat Feb 10 08:31:16 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AIELNVGRKVTVTVPGSSANLGPGFDTLGLALSVYDTVEVEIIPSGLEVEVFGEGQGEVPLDGSHLVVKA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


TT
TTT
SS


TTS


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence IRAGLKAADAEVPGLRVVCHNNIPQSRGLGSSAAAAVAGVAAANGLADFPLTQEQIVQLSSAFEGHPDNA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT
S
S
TTSSS
TTS
S
TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence AASVLGGAVVSWTNLSIDGKSQPQYAAVPLEVQDNIRATALVPNASTEAVRRVLPTEVTHIDARFNVSRV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
S




SSSS






TT




S
TTSSS
S


 .........220.........230.........240.........250.........260.........270.........280
Sequence AVMIVALQQRPDLLWEGTRDRLHQPYRAEVLPITSEWVNRLRNRGYAAYLSGAGPTAMVLSTEPIPDKVL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) T
GGGT

SSS
TTTTT

TTSS
SS


 .........290.........300......
Sequence EDARESGIKVLELEVAGPVKVEVNQP
Predicted secondary structure










SS confidence

























Known secondary structure (DSSP) TT
B





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D