Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5watB_

Fold library idPDB HeaderMoleculeTitle
c5watB_2.14PDB header: transferaseChain: B: PDB Molecule: homoserine kinase;


Added to library: Sat Feb 10 08:31:16 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AIELNVGRKVTVTVPGSSANLGPGFDTLGLALSVYDTVEVEIIPSGLEVEVFGEGQGEVPLDGSHLVVKA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


TT
TTT
SS


TTS


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence IRAGLKAADAEVPGLRVVCHNNIPQSRGLGSSAAAAVAGVAAANGLADFPLTQEQIVQLSSAFEGHPDNA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT
S
S
TTSSS
TTS
S
TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence AASVLGGAVVSWTNLSIDGKSQPQYAAVPLEVQDNIRATALVPNASTEAVRRVLPTEVTHIDARFNVSRV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
S




SSSS






TT




S
TTSSS
S


 .........220.........230.........240.........250.........260.........270.........280
Sequence AVMIVALQQRPDLLWEGTRDRLHQPYRAEVLPITSEWVNRLRNRGYAAYLSGAGPTAMVLSTEPIPDKVL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) T
GGGT

SSS
TTTTT

TTSS
SS


 .........290.........300......
Sequence EDARESGIKVLELEVAGPVKVEVNQP
Predicted secondary structure










SS confidence

























Known secondary structure (DSSP) TT
B





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D