Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w8sA_

Fold library idPDB HeaderMoleculeTitle
c5w8sA_2.10PDB header: transferaseChain: A: PDB Molecule: lipid-a-disaccharide synthase;


Added to library: Sat Feb 3 08:30:27 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RPLTIALVAGETSGDILGAGLIRALKEHVPNARFVGVAGPRMQAEGCEAWYEMEELASRRSSHIRADLTK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)



S
TT

TT
GGGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence RFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRATDLVLAFLPFEKAFY
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

SS
TT

S

TTT

S
SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DKYNVPCRFIGHTMADAMPLDPDKNAARDVLGIPHDAHCLALLPGSRGAEVESLSADFLKTAQLLRQTYP
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT




S
SS

T

TTS


SS
T
 .........220.........230.........240.........250.........260.........270.........280
Sequence DLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLSKCPMVVGYR
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T

S
TT


S

SS
TTTT




 .........290.........300.........310.........320.........330.........340.........350
Sequence MKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQKLAAALLPLLANGKTSHAMHDTFRELHQQ
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

S

STS
SS



GGG

TTS
 .........360........
Sequence IRCNADEQAAQAVLELAQ
Predicted secondary structure




SS confidence

















Known secondary structure (DSSP) T
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D