Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w7dA_

Fold library idPDB HeaderMoleculeTitle
c5w7dA_1.75PDB header: hydrolaseChain: A: PDB Molecule: acyloxyacyl hydrolase;


Added to library: Sat Jan 6 08:16:55 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SHGQSCLGCVVLVSVIEQLAEVHNSSVQVAMERLCSYLPEKLFLKTACYFLVQTFGSDIIKLLDEAMKAD
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
T

S
SGGGTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence VVCYALEFCKRGAVQPQCHLYPLPQEAWESALEKARQVLRRSCSLPFLTKICQKIELSIKKAVPFKDVDS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTSS

BTTB



SS





STT

S
S

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DKHSVFPTLRGYHWRGRDCNDSDKTVYPGRRPDNWDIHQDSNCNGIWGIDPKDGIPYEKKFCEGSQPRGI
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) SS

SSSSTTSTTTB


S
TT
TT
STTB

SGGGSSS
TTSSS

SB
TTT

BTTS


 .........220.........230.........240.........250.........260.........270.........280
Sequence ILLGDAAGAHFHIPPEWLTASQMSVNSFLNLPSALTDELNWPQLSGVTGFLDSTSGIEEKSIYHRLRKRN
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTTTTB


GGGT
GGG
SGGGGTTTTTB
GGGSTTT

S

SS

S



 .........290.........300.........310.........320.........330.........340.........350
Sequence HCNHRDYQSISKNGASSRNLKNFIESLSRNQASDHPAIVLYAMIGNDVCNSKADTVPEMTTPEQMYANVM
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) GGGTT

TT

TTTGGGTGGG



TTTB



STTT



SSS

 .........360.........370.........380.........390.........400.........410.........420
Sequence QTLTHLNSHLPNGSHVILYGLPDGTFLWDSLHNRYHPLGQLNKDVTYAQFFSFLRCLQLNPCNGWMSSNK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S
TT



TTTSB
GGGTTTT

BTT

S
TTTSSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence TLRTLTSERAEQLSNTLKKIATTETFANFDLFYVDFAFHEIIEDWQKRGGQPWQLIEPVDGFHPNEVASL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT


SS


TT

GGGGB
TTTSSSB
 .........500.........510.........520........
Sequence LQANRVWEKIQLQWPHVLGKENPFNSQIEEVFGDQGGH
Predicted secondary structure














SS confidence





































Known secondary structure (DSSP)
GGGG



TTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D