Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w7dA_

Fold library idPDB HeaderMoleculeTitle
c5w7dA_1.75PDB header: hydrolaseChain: A: PDB Molecule: acyloxyacyl hydrolase;


Added to library: Sat Jan 6 08:16:55 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SHGQSCLGCVVLVSVIEQLAEVHNSSVQVAMERLCSYLPEKLFLKTACYFLVQTFGSDIIKLLDEAMKAD
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
T

S
SGGGTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence VVCYALEFCKRGAVQPQCHLYPLPQEAWESALEKARQVLRRSCSLPFLTKICQKIELSIKKAVPFKDVDS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTSS

BTTB



SS





STT

S
S

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DKHSVFPTLRGYHWRGRDCNDSDKTVYPGRRPDNWDIHQDSNCNGIWGIDPKDGIPYEKKFCEGSQPRGI
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) SS

SSSSTTSTTTB


S
TT
TT
STTB

SGGGSSS
TTSSS

SB
TTT

BTTS


 .........220.........230.........240.........250.........260.........270.........280
Sequence ILLGDAAGAHFHIPPEWLTASQMSVNSFLNLPSALTDELNWPQLSGVTGFLDSTSGIEEKSIYHRLRKRN
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTTTTB


GGGT
GGG
SGGGGTTTTTB
GGGSTTT

S

SS

S



 .........290.........300.........310.........320.........330.........340.........350
Sequence HCNHRDYQSISKNGASSRNLKNFIESLSRNQASDHPAIVLYAMIGNDVCNSKADTVPEMTTPEQMYANVM
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) GGGTT

TT

TTTGGGTGGG



TTTB



STTT



SSS

 .........360.........370.........380.........390.........400.........410.........420
Sequence QTLTHLNSHLPNGSHVILYGLPDGTFLWDSLHNRYHPLGQLNKDVTYAQFFSFLRCLQLNPCNGWMSSNK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S
TT



TTTSB
GGGTTTT

BTT

S
TTTSSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence TLRTLTSERAEQLSNTLKKIATTETFANFDLFYVDFAFHEIIEDWQKRGGQPWQLIEPVDGFHPNEVASL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT


SS


TT

GGGGB
TTTSSSB
 .........500.........510.........520........
Sequence LQANRVWEKIQLQWPHVLGKENPFNSQIEEVFGDQGGH
Predicted secondary structure














SS confidence





































Known secondary structure (DSSP)
GGGG



TTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D