Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w6pB_

Fold library idPDB HeaderMoleculeTitle
c5w6pB_2.34PDB header: viral protein, hydrolaseChain: B: PDB Molecule: tailspike protein 2;


Added to library: Sat Oct 27 08:27:16 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DSFINVINTLGRNDGAKYIGECHSVADLRNTEPTMDGQRIILKQHTAGTLLGGGVFRALIDGTGKTDNNG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
STTGGGGS

BSST


SSTT
SSTT


S

TT



SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence TVIKTVGGAAWLRVNADRVNPFMFGALGGSNDDTIPVQSCVDSGKATQLTDAHYVSNIQLKYNTSSIYGS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S
TTS


SS
B
GGGGT


TTSB
TTTS


SS

STT


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence GLHYSRLHQLPSATGNCITIKDTCSLIVLDAFGVYGTGAQQGTSFTAGTTGIYVETPSGLSADYPFHTTA
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) SSSSS
TT


TT

S
S

TT
STT



TT






SSTTS

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DPRRDLCISKVHIAGFDEYGLNIDSGNFSVTTDSLLVNHINQVGVRCATTDWTWTNIQVNTCGKQCLVLD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
SS


SS
TT
S
SS

SS
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GCGNGRIIGGKFIWANWQPYGTVGQFPGITINNSQNMVINGIEVQDCGGNGIEISESYSISMNGLNTNRN
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
S
S
GGG


S


SS
S
SS
SS


S
 .........360.........370.........380.........390.........400.........410.........420
Sequence GINANNTFYNIVFNKSDAVINGFVGLNYAANSGSGANSSAGNFQFLSNDCSVTINGVVETGYMGINFIGD
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTSTT

S



T





SS
S


SS




TTS

S
 .........430.........440.........450.........460.........470.........480.........490
Sequence NNIINPTNSDLSINGLVNYSKTGLQTMNETPTFDGVSTTPVYVSVPSSVGQVNGLRLSQANKDKLLYSRT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
SB




STT


GGG









SSS
S



GGGSSS
TTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence AGPEGITMAAVIVPTISGAEVFNFMAIGSGFSDTSNSLHLQLVIDASGKQTIALLLGGDGTTQILSGDLP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

TT



SSSS

STT


TT

TT

 .........570.........580.........590.........600.........610.........620.........630
Sequence NDLKLQSGVPYHIAIGAKPGYFWWSILNIQTGKRIRRSFRGAYLAVPFNSIFGLTSSLTFFSDSNAGGDA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GGG


TT

TTTTT
BGGG
SS

GGGGSS

SS
SSTTS

 .........640.........650.........660.........670......
Sequence CSGVGAKVYVGMFSSENDYVASRYYNLINPVDPTKLISYRILDSSI
Predicted secondary structure




















SS confidence













































Known secondary structure (DSSP)
S


TT
SSS
S
GGG

SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D