Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w6hB_

Fold library idPDB HeaderMoleculeTitle
c5w6hB_2.29PDB header: viral protein, hydrolaseChain: B: PDB Molecule: tailspike protein 4;


Added to library: Sat Oct 27 08:27:34 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSGSTLREVARVTNVKDTEVIYFSVGAVLSGYKVIYDKVTQRSYFIPELPTGTTAVSLSSSAILVHSAGS
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

T

GGG

TT
B
TT
STTTT




TT
B
TT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VDLGALAVSREEYVTLSGTFDSGAVINTKNELLTHTDGKYRWDGTLPKTVAAGSTPATTGGVGSGAWLSV
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TT

TTT

STT
SS

SSSS
TT

TTTTT
BSTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GDASLKSNLNKPNGLSYIGTVSSVSELSSIAGLIGDSIILDSYVDGFNLGGGVMVAVNSDTVVDNIVTFQ
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) STSTTGGGGS

B

TT
B

TT
SSTTS


TTS


SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence GNGVVWKRKLFNGVADVYEAGYTGTGDLAIFINKINAVGFDCIVPVSGEITTPIIFDIAKGALIGKNKCT
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
BSSTT

S
TTTTT

SSSBTS

S

S
TTT


SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LIESASATGDYYLTIVNTDTDYTNRDVINATALMTGVSFVGKGTRKLAIGGSTSGEVSELRISNCGFIST
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TT

SS




T
S


SS


TTS

S
S
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence AGIEFLDNAYRILFDKCALSRSFTNSVIFNSPANSGEVIKFNHCWMVDNGGPFTFKNGQFIFDSCSLPAG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S

TT

S
S
BS
S

TT

TTS
B

SBBS
S
S

 .........430.........440.........450.........460.........470.........480.........490
Sequence KKSGYFDPVVALSDNATTVFTNGNIEYQPGQSFVGFTVDGSSRLSISDSTILLPNDYSTVPIVNNGDGVV
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) B
TTS



TT
S

TT





TT
S


TT

S
S
TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence SLNNCSLPLYGSTTIATGFATRQLIGGLSKKIMSRGCYPRAGFITSNWNLGCIVSPYINSVSNGSGQFEN
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S


BS
SSTTTTSSSSBSSS


S
TT


TT
GGGB
BS
TTS


SSTTSTTSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence ISNWTLSQTGTDVVTVTTGNDVPNDLMFSTSFVLSVPTVGAAANFTQTIIDCEPGRYFQLGFWAKNTTTT
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TT

SSS

S

S

SS
S

STT




TTSSS
 .........640.........650.........660.........670.........680.........690.......
Sequence LASIRFLDQQGNAVADSIGYNIPVGNTFNFYALVDCVPPGAYRAEINFNVSSIVGGIAIHNVIYGLI
Predicted secondary structure























SS confidence


































































Known secondary structure (DSSP)
TTS
B
S





SS


TT

SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D