Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w6fB_

Fold library idPDB HeaderMoleculeTitle
c5w6fB_2.18PDB header: viral protein, hydrolaseChain: B: PDB Molecule: tailspike protein 3;


Added to library: Sat Oct 27 08:25:22 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TSIEVNKQSIARNFGVKEDEVIYFTAGIDLSGFKVIYDESTQRAYSLPFGIVSGTTAISLDERAILTHSA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
T

GGG

TT
B
TT
STTTT

S


TT
B
TT
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence GSVDLGELAVSREEYVTLPGSFNFGHTINVKNELLVHDDKKYRWDGSLPKVVAAGSTPDSSGGVGLGAWL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
TT


SS
TTT


TTTT
SSS

TT

TTTTT
BSTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence SVGDAALRAELNTKVSDGTFPATIKYKYGLPSVIDGAIYRTVQDKLDDFVFLEDFGGKDDAGSTDNSIAF
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SSS
STTTTS

TT

TTS
BGGGGT


STTSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence RKAFASGARKIRLRGSGVYGMATRDIELPAKYEIIGNAKNPEIKYLGTDTSFTMFTLTGSGPASNQWKQG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT




SS

S



TT

STT


SS
TT

S
SSSSGGG

 .........290.........300.........310.........320.........330.........340.........350
Sequence GMFRDLIISSDVKINWMLGRHVQNLDYDRVFFYNSATVLNNYHYVNFTRCERWGSAFIGRADLNTIQFIS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
S
S


TT
TTT

 .........360.........370.........380.........390.........400.........410.........420
Sequence ESPKFHLCFSSGSPIDVWDTADLAITKCTMFAGDYAVRTRVTQKQVTAPDLFAGYPVLITCSVFDAVRGH
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S
S

S
S

SS
S
S




TT




B
S
SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence AWDLEGSVYSTITGNLVSAGRDTNSHGAYIKGGRSLSLTGNVFTYCGNYGLVLEDVQQSGFVGNVFNGNK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SS
S

TTTT

SS
S
S
SSS
S
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence TGGLGTLACKDLSIVGGSMGTTYVRGGYYTQPVGYSDISSNSTGILLSGVAFDEALTTKVYLDTSITTRN
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SS
S




TT





TTS

S

TT
S


STTS

 .........570.........580.........590.........600.........610......
Sequence KVINCSGVPDTIARGSTANRPANPQASYQYYDTTLGIPIWWNSVSGTWKNAAGADV
Predicted secondary structure



































SS confidence























































Known secondary structure (DSSP) SBTTB





GGGS
SS

TT
TTTTTTTT
TTS
B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D