Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w5aB_

Fold library idPDB HeaderMoleculeTitle
c5w5aB_1.85PDB header: transcriptionChain: B: PDB Molecule: hth-type transcriptional regulator cmr;


Added to library: Sat Dec 16 08:40:59 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GQPPSEAQVRQAAWIARCVGRGGSAPLHRDDVSALAETLQVKEFAPGAVVFHADQTADGVWIVRHGLIEL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)




GGG
B
GGG
SS
TTTTS
TT

TTSB

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence AVGSRRRRAVVNILHPGDVDGDIPLLLEXPXVYTGRALTQATCLFLDRQAFERLLATHPAIARRWLSSVA
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S
STT

TT
STT
B
SSSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence QRVSTAQIRLXGXLGRPLPAQVAQLLLDEAIDARIELAQRTLAAXLGAQRPSINKILKEFERDRLITVGY
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTS

BTT


T

TTS
S
 .........220......
Sequence AVIEITDQHGLRARAQ
Predicted secondary structure




SS confidence















Known secondary structure (DSSP) S
S
T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D