Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w21B_

Fold library idPDB HeaderMoleculeTitle
c5w21B_3.00PDB header: hydrolase/protein bindingChain: B: PDB Molecule: fibroblast growth factor 23;


Added to library: Sat Jan 27 09:03:54 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DDKAMGYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)












SSSSS



SS

TTS
SS

STT

SSST
 .........80.........90.........100.........110.........120.........130.........140
Sequence MSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGAAKAAFLPGMNPPPYSQFL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TTT
TTS
SS

TTTS

SSS

TTT

B

SSS





SSS


TT

 .........150.........160.........170.........180..
Sequence SRRNEIPLIHFNTPIPRQHTQSAEDDSERDPLNVLKPRARMT
Predicted secondary structure



































SS confidence









































Known secondary structure (DSSP)

S
GGGSS







SS


S

S
TT










Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D