Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w21A_

Fold library idPDB HeaderMoleculeTitle
c5w21A_3.00PDB header: hydrolase/protein bindingChain: A: PDB Molecule: klotho;


Added to library: Sat Jan 27 10:24:09 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPPLQPAT
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
TTTTTTTSS







TT


STTTT

TTSTT


B



SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence GDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
SSTT

SS
ST
S


SSTTT
S

T
 .........150.........160.........170.........180.........190.........200.........210
Sequence YHWDLPQRLQDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGIRGSP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SS

BSTT
GGGSTTGGGT


TS

SSS




 .........220.........230.........240.........250.........260.........270.........280
Sequence RLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSSHWINPRRMTDHSIKECQKSLDFVLGWFAKPV
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTT




SSS
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence FIDGDYPESMKNNLSSILPDFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWI
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TSSS

TSSSS



TT

SS
STT




S
SGGG
S



 .........360.........370.........380.........390.........400.........410.........420
Sequence DLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTS





TT

S

TT


S
SB



GGGTTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence IRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQF
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)

S

TTSSS



T


GGGS




TT
TT




S
SSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence TDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQV
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)






SSS


SS








STT
TTTT
S

STTSSSSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence NHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENPYTALAFAEYARLCFQELGHHV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TT

S
TTTTTS
TTGGGSTGGGT
 .........640.........650.........660.........670.........680.........690.........700
Sequence KLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAER
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
S

TTT

TTTTS



SSTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence VLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TSSSS

TT







TT

SS


SS
S
G
 .........780.........790.........800.........810.........820.........830.........840
Sequence IKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYM
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) GGTTTT

TTS
B
TT

B


S






TTSST
 .........850.........860.........870.........880.........890.........900.........910
Sequence QNYINEALKAHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPRFCPE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TS


S
SBTTTSTTT
SSSS

T







 .........920..
Sequence EFTVCTECSFFH
Predicted secondary structure








SS confidence











Known secondary structure (DSSP)

SS
TTSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D