Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w21A_

Fold library idPDB HeaderMoleculeTitle
c5w21A_3.00PDB header: hydrolase/protein bindingChain: A: PDB Molecule: klotho;


Added to library: Sat Jan 27 10:24:09 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPPLQPAT
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
TTTTTTTSS







TT


STTTT

TTSTT


B



SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence GDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
SSTT

SS
ST
S


SSTTT
S

T
 .........150.........160.........170.........180.........190.........200.........210
Sequence YHWDLPQRLQDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGIRGSP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SS

BSTT
GGGSTTGGGT


TS

SSS




 .........220.........230.........240.........250.........260.........270.........280
Sequence RLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSSHWINPRRMTDHSIKECQKSLDFVLGWFAKPV
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTT




SSS
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence FIDGDYPESMKNNLSSILPDFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWI
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TSSS

TSSSS



TT

SS
STT




S
SGGG
S



 .........360.........370.........380.........390.........400.........410.........420
Sequence DLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTS





TT

S

TT


S
SB



GGGTTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence IRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQF
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)

S

TTSSS



T


GGGS




TT
TT




S
SSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence TDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQV
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)






SSS


SS








STT
TTTT
S

STTSSSSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence NHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENPYTALAFAEYARLCFQELGHHV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TT

S
TTTTTS
TTGGGSTGGGT
 .........640.........650.........660.........670.........680.........690.........700
Sequence KLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAER
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
S

TTT

TTTTS



SSTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence VLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TSSSS

TT







TT

SS


SS
S
G
 .........780.........790.........800.........810.........820.........830.........840
Sequence IKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYM
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) GGTTTT

TTS
B
TT

B


S






TTSST
 .........850.........860.........870.........880.........890.........900.........910
Sequence QNYINEALKAHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPRFCPE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TS


S
SBTTTSTTT
SSSS

T







 .........920..
Sequence EFTVCTECSFFH
Predicted secondary structure








SS confidence











Known secondary structure (DSSP)

SS
TTSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D