Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w1eA_

Fold library idPDB HeaderMoleculeTitle
c5w1eA_2.06PDB header: transcriptionChain: A: PDB Molecule: putative transcriptional regulator;


Added to library: Sat Dec 16 08:49:39 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DEAVAPLLRGIAVLGRLTGADGGTLSLSALERTTGLARSTVDRLTATLARMGYVRLDGRDVVLAPRLMEL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)



SGGG


TTSTT
GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence GNAYLAALRLPALLSARADGLADELDESVSLAVGDRDGIRFIHQATRRRAMSLSFRIGDLLPAERTAPGP
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
TSTT

S
TTS



TT
GGGSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LFAAEWTASDWHRWRERRAADPGDHSFPAVPPREPGAPGEDFARRAAKAAADGWALDDQLIEPGLVAVSV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT


TT
TT
TTS



TT




S
SSSSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence PVRDPGTGRVACVASVVSHTSRHTAPDLRAALLPRLRAAVAAMEDDLRAAPAPEPGPPPAGLALWTGASK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TTT
STTT

T






S



TTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence QELGREFVESLARGLTVLTAFGEGRSALTLTQVAQATGLARATARRALLTHARAGLVAPAAGHTFTLTPR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GGG

TT
BTTBST

TTSTTT
GG
 .........360.........370.........380.........390.........400.........410.........420
Sequence VLSLGFPPLSRTSLPEIAQPHLTALAERVHESASLAVLADSGEEIQYTARASALPARATALGRVLLALPE
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) GGGTTTT

TS
TTSSB


BGGGSTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence VRARGYALVDEELEAGLRAIAVPVRDRTGRVVAALNVALHAARRTADDCVAQILPELRHTADLVETELRV
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) S
TTTT
TTS

SS

 .........500
Sequence AGRFCRVAVV
Predicted secondary structure








SS confidence









Known secondary structure (DSSP) TTTS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D