Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5vztB_

Fold library idPDB HeaderMoleculeTitle
c5vztB_2.70PDB header: cell cycleChain: B: PDB Molecule: f-box only protein 31;


Added to library: Sat Jan 20 10:28:54 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SGRSLLELPPELLVEIFASLPGTDLPSLAQVCTKFRRILHTDTIWRRRCREEYGVCENLRKLEITGVSCR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)



GGGS
TS
TTTTT
TT





TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence DVYAKLLHRYRHILGLWQPDIGPYGGLLNVVVDGLFIIGWMYLPPHDPHVDDPMRFKPLFRIHLMERKAA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTTTTGGG


TT
B

TT

STT
TTS



TTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence TVECMYGHKGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILM
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)

SSS


SSSS
GGGT

TT
T


SSTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence KFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQ
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TSSS


B



SSS
S


GGG

SSSB

SSS
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence TVEIDLRHRIQLPDLENQRNFNELSRIVLEVRERVRQEQQEGQPFVLPVGVSSRNEDYPRTCRMCFYGTG
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)



S
TT


B



TT
S
S


SB
S
 .........360.........370.........380.........390.........400.........410........
Sequence LIAGHGFTSPERTPGVFILFDEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDEMLKNIQSLTS
Predicted secondary structure






























SS confidence



































































Known secondary structure (DSSP) TTTTTGGGT




TT
B
SSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D