Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5vykC_

Fold library idPDB HeaderMoleculeTitle
c5vykC_1.75PDB header: signaling proteinChain: C: PDB Molecule: chimera protein of brs domain of braf and cc-sam domain of


Added to library: Sat Feb 17 08:20:19 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AASRALQQCGQLQKLIDISIGSLRGLRTKCAVSNDLTQQEIRTLEAKLVRYICKQRQCKLSVAPGERTPE
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)
S
TTSS
STT

 .........80.........90.........100.........110.........120.........130.........140
Sequence LNSYPRFSDWLYTFNVRPEVVQEIPRDLTLDALLEMNEAKVKETLRRCGASGDECGRLQYALTCLRKVTA
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) T
S
TT

TS
TT

S
TT



 .........150.........160.........170.........180.........190.........200...
Sequence IPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGN
Predicted secondary structure








SS confidence






























































Known secondary structure (DSSP) TT
SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D