Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5vqdA_

Fold library idPDB HeaderMoleculeTitle
c5vqdA_2.10PDB header: hydrolaseChain: A: PDB Molecule: beta-glucoside phosphorylase bglx;


Added to library: Sat Jan 20 10:38:56 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MYESILSIKPYNLSKEQITWVNQTLVSLSDDEKLGQLICEIIWLDVMKHFLPGAVMYRPFKAKRMREFTQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

TSTTT




T




SS


S
S

 .........80.........90.........100.........110.........120.........130.........140
Sequence RLQKASKIPLLIACNLERGGSGGNGGMEDGTYVASPMGVAATDDESSAEHLGEVCASEGSAVGVNWTYEP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
SS




SBSS
TT
S
TTS
B


TT
TT




 .........150.........160.........170.........180.........190.........200.........210
Sequence IIDIDMNPENPITNVRTYGSDPERIIRMAKAYCRGCRKWGVLTTIKHFPGDGVDYRDQHLMSSVNNLSAD
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) B





TT
SSSGGGSS
S
TTT
B
T
SSSSSS
TTTS

B



 .........220.........230.........240.........250.........260.........270.........280
Sequence EWMDTYGRIYQALIEDGAETLMSAHIRQPNVTRMVNPLIKDEEIMPGSLSKELMQGILRGRFHFNGLICT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT


S
B

TT

TTT


GGG











S
 .........290.........300.........310.........320.........330.........340.........350
Sequence DATQMVGYTCSMPRHEALPTSIQNGADMLTFTLNPTEDFKALQEGLSCGLLTHERLDEAVARILGMKAKL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTSTSS
TT
S

SSTSS
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence RLPERKDVVPPLHAMERIQSKKHKKWALEIADESITLVKDKQKGLLPLSPQKTKRIILVQATNEKPEGGY
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TTTT
SS
S

GGGGGGTT


STT

S

TTT

S


TTSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence LSEARLFKGLLEKEGFIVHWFEEVPRPGTGYSIEDLKRDTDLFIYYANFKVSSNQTTIRLVWGDSSPKFV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
T
GGGS

SBTTB

S



TT
S

S



TTSSTTT
 .........500.........510.........520.........530.........540.........550.....
Sequence CDVPTLFLSFSNPYHLVDVPMVKTYINAYTSNEATVRMMIEKLMGRSSFKGKSPVDPFAGLWDAR
Predicted secondary structure






































SS confidence
































































Known secondary structure (DSSP) TTS
SS
TTGGGT
TT
S



STTSS





SS
TTTT
GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D