Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5vqdA_

Fold library idPDB HeaderMoleculeTitle
c5vqdA_2.10PDB header: hydrolaseChain: A: PDB Molecule: beta-glucoside phosphorylase bglx;


Added to library: Sat Jan 20 10:38:56 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MYESILSIKPYNLSKEQITWVNQTLVSLSDDEKLGQLICEIIWLDVMKHFLPGAVMYRPFKAKRMREFTQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

TSTTT




T




SS


S
S

 .........80.........90.........100.........110.........120.........130.........140
Sequence RLQKASKIPLLIACNLERGGSGGNGGMEDGTYVASPMGVAATDDESSAEHLGEVCASEGSAVGVNWTYEP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
SS




SBSS
TT
S
TTS
B


TT
TT




 .........150.........160.........170.........180.........190.........200.........210
Sequence IIDIDMNPENPITNVRTYGSDPERIIRMAKAYCRGCRKWGVLTTIKHFPGDGVDYRDQHLMSSVNNLSAD
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) B





TT
SSSGGGSS
S
TTT
B
T
SSSSSS
TTTS

B



 .........220.........230.........240.........250.........260.........270.........280
Sequence EWMDTYGRIYQALIEDGAETLMSAHIRQPNVTRMVNPLIKDEEIMPGSLSKELMQGILRGRFHFNGLICT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT


S
B

TT

TTT


GGG











S
 .........290.........300.........310.........320.........330.........340.........350
Sequence DATQMVGYTCSMPRHEALPTSIQNGADMLTFTLNPTEDFKALQEGLSCGLLTHERLDEAVARILGMKAKL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTSTSS
TT
S

SSTSS
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence RLPERKDVVPPLHAMERIQSKKHKKWALEIADESITLVKDKQKGLLPLSPQKTKRIILVQATNEKPEGGY
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TTTT
SS
S

GGGGGGTT


STT

S

TTT

S


TTSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence LSEARLFKGLLEKEGFIVHWFEEVPRPGTGYSIEDLKRDTDLFIYYANFKVSSNQTTIRLVWGDSSPKFV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
T
GGGS

SBTTB

S



TT
S

S



TTSSTTT
 .........500.........510.........520.........530.........540.........550.....
Sequence CDVPTLFLSFSNPYHLVDVPMVKTYINAYTSNEATVRMMIEKLMGRSSFKGKSPVDPFAGLWDAR
Predicted secondary structure






































SS confidence
































































Known secondary structure (DSSP) TTS
SS
TTGGGT
TT
S



STTSS





SS
TTTT
GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D