Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5vooB_

Fold library idPDB HeaderMoleculeTitle
c5vooB_2.40PDB header: transferaseChain: B: PDB Molecule: 5-methyltetrahydrofolate homocysteine s-methyltransferase;


Added to library: Sat Jan 20 10:21:53 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLFLVGERLNATGSKRFREMLFARDLEGILALAREQVEEGAHALDLSVAWTGRDELEDLRWLLPHLATAL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

TTT
TT
TT
S


TTS

 .........80.........90.........100.........110.........120.........130.........140
Sequence TVPVMVDSTSPEAMELALKYLPGRVLLNSANLEDGLERFDRVASLAKAHGAALVVLAIDEKGMAKTREEK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
S

S
STT

STT
T
STT

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence VRVALRMYERLTEHHGLRPEDLLFDLLTFPITQGDEESRPLAKETLLAMEELRERLPGVGFVLGVSNVSF
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT


GGG




GGG
STTTTTSTT
GGGGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GLKPRARRVLNSVFLDEARKRGLTAAIVDAGKILPISQIPEEAYALALDLIYDRRKEGFDPLLAFMAYFE
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TS
T


GGG


GGGS
TT

BTTB
 ..
Sequence AH
Predicted secondary structure

SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D