Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5vooB_

Fold library idPDB HeaderMoleculeTitle
c5vooB_2.40PDB header: transferaseChain: B: PDB Molecule: 5-methyltetrahydrofolate homocysteine s-methyltransferase;


Added to library: Sat Jan 20 10:21:53 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLFLVGERLNATGSKRFREMLFARDLEGILALAREQVEEGAHALDLSVAWTGRDELEDLRWLLPHLATAL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

TTT
TT
TT
S


TTS

 .........80.........90.........100.........110.........120.........130.........140
Sequence TVPVMVDSTSPEAMELALKYLPGRVLLNSANLEDGLERFDRVASLAKAHGAALVVLAIDEKGMAKTREEK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
S

S
STT

STT
T
STT

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence VRVALRMYERLTEHHGLRPEDLLFDLLTFPITQGDEESRPLAKETLLAMEELRERLPGVGFVLGVSNVSF
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT


GGG




GGG
STTTTTSTT
GGGGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GLKPRARRVLNSVFLDEARKRGLTAAIVDAGKILPISQIPEEAYALALDLIYDRRKEGFDPLLAFMAYFE
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TS
T


GGG


GGGS
TT

BTTB
 ..
Sequence AH
Predicted secondary structure

SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D