Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5vanA_

Fold library idPDB HeaderMoleculeTitle
c5vanA_2.20PDB header: signaling proteinChain: A: PDB Molecule: beta-klotho;


Added to library: Sat Feb 3 08:32:19 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FSGDGRAIWSQLFLYDTFPKNFFWGIGTGALQVEGSWKKDGKGPSIWDHFIHTHLGSSDSYIFLEKDLSA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TTGGGGGG






B

TT





TTGGG


B




TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LDFIGVSFYQFSISWPRLFPDGIVTVANAKGLQYYSTLLDALVLRNIEPIVTLYHWDLPLALQEKYGGWK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) T
S


TTSSSSS

TT
SS

B
GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence NDTIIDIFNDYATYCFQMFGDRVKYWITIHNPYLVAWHGYGTGMHAPGEKGNLAAVYTVGHNLIKAHSKV
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) STTTTS


TBS
STT

BS
 .........220.........230.........240.........250.........260.........270.........280
Sequence WHNYNTHFRPHQKGWLSITLGSHWIEPQRSENTMDIFKCQQSMVSVLGWFANPIHGDGDYPEGMRKKLFS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T




SSTT
TSSSS

TTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VLPIFSEAEKHEMRGTADFFAFSFGPNNFKPLNTMAKMGQNVSLNLREALNWIKLEYNNPRILIAENGWF
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TS



TT

SSSGGGTSSGGGS

TT


TTS




 .........360.........370.........380.........390.........400.........410.........420
Sequence TDSRVKTEDTTAIYMMKNFLSQVLQAIRLDEIRVFGYTAWSLLDGFEWQDAYTIRRGLFYVDFNSKQKER
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT

S

TT



SB



GGGTTS

S
TTSSS

 .........430.........440.........450.........460.........470.........480.........490
Sequence KPKSSAHYYKQIIRENGFSLKESTPDVQGQFPCDFSWGVTESVLKPEQCTDFVNIKKQLEMLARMKVTHY
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
TBS

TT







TT





GGG
TTS

S
 .........500.........510.........520.........530.........540.........550.........560
Sequence RFALDWASVLPTGQLSAVNRQALRYYRCVVSEGLKLGISAMVTLYYPTHAHLGLPEPLLHADGWLNPSTA
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TTS
GGG

TT



SS




TTGGGST
 .........570.........580.........590.........600.........610.........620.........630
Sequence EAFQAYAGLCFQELGDLVKLWITINEPNRLSDIYNRSGNDTYGAAHNLLVAHALAWRLYDRQFRPSQRGA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTT


GGG
TTTS
S
T

 .........640.........650.........660.........670.........680.........690.........700
Sequence VSLSLHADWAEPANPYADSHWRAAERFLQFEIAWFAEPLFKTGDYPAAMREYIASKHRRGLSSSALPRLT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

SSTT
TTTSS

TTS








 .........710.........720.........730.........740.........750.........760.........770
Sequence EAERRLLKGTVDFCALNHFTTRFVMHEQLAGSRYDSDRDIQFLQDITRLSSPTRLAVIPWGVRKLLRWVR
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT

SS






SSSTT

TTS
B
TT

B

 .........780.........790.........800.........810.........820.........830.........840
Sequence RNYGDMDIYITASGIDDQALEDDRLRKYYLGKYLQEVLKAYLIDKVRIKGYYAFKLAEEKSKPRFGFFTS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
S






S
SS

TT



SB

TTS



SB
T
 .........850.........860.
Sequence DFKAKSSIQFYNKVISSRGFP
Predicted secondary structure








SS confidence




















Known secondary structure (DSSP) T

B
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D