Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5vanA_

Fold library idPDB HeaderMoleculeTitle
c5vanA_2.20PDB header: signaling proteinChain: A: PDB Molecule: beta-klotho;


Added to library: Sat Feb 3 08:32:19 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FSGDGRAIWSQLFLYDTFPKNFFWGIGTGALQVEGSWKKDGKGPSIWDHFIHTHLGSSDSYIFLEKDLSA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TTGGGGGG






B

TT





TTGGG


B




TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LDFIGVSFYQFSISWPRLFPDGIVTVANAKGLQYYSTLLDALVLRNIEPIVTLYHWDLPLALQEKYGGWK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) T
S


TTSSSSS

TT
SS

B
GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence NDTIIDIFNDYATYCFQMFGDRVKYWITIHNPYLVAWHGYGTGMHAPGEKGNLAAVYTVGHNLIKAHSKV
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) STTTTS


TBS
STT

BS
 .........220.........230.........240.........250.........260.........270.........280
Sequence WHNYNTHFRPHQKGWLSITLGSHWIEPQRSENTMDIFKCQQSMVSVLGWFANPIHGDGDYPEGMRKKLFS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T




SSTT
TSSSS

TTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VLPIFSEAEKHEMRGTADFFAFSFGPNNFKPLNTMAKMGQNVSLNLREALNWIKLEYNNPRILIAENGWF
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TS



TT

SSSGGGTSSGGGS

TT


TTS




 .........360.........370.........380.........390.........400.........410.........420
Sequence TDSRVKTEDTTAIYMMKNFLSQVLQAIRLDEIRVFGYTAWSLLDGFEWQDAYTIRRGLFYVDFNSKQKER
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT

S

TT



SB



GGGTTS

S
TTSSS

 .........430.........440.........450.........460.........470.........480.........490
Sequence KPKSSAHYYKQIIRENGFSLKESTPDVQGQFPCDFSWGVTESVLKPEQCTDFVNIKKQLEMLARMKVTHY
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
TBS

TT







TT





GGG
TTS

S
 .........500.........510.........520.........530.........540.........550.........560
Sequence RFALDWASVLPTGQLSAVNRQALRYYRCVVSEGLKLGISAMVTLYYPTHAHLGLPEPLLHADGWLNPSTA
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TTS
GGG

TT



SS




TTGGGST
 .........570.........580.........590.........600.........610.........620.........630
Sequence EAFQAYAGLCFQELGDLVKLWITINEPNRLSDIYNRSGNDTYGAAHNLLVAHALAWRLYDRQFRPSQRGA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTT


GGG
TTTS
S
T

 .........640.........650.........660.........670.........680.........690.........700
Sequence VSLSLHADWAEPANPYADSHWRAAERFLQFEIAWFAEPLFKTGDYPAAMREYIASKHRRGLSSSALPRLT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

SSTT
TTTSS

TTS








 .........710.........720.........730.........740.........750.........760.........770
Sequence EAERRLLKGTVDFCALNHFTTRFVMHEQLAGSRYDSDRDIQFLQDITRLSSPTRLAVIPWGVRKLLRWVR
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT

SS






SSSTT

TTS
B
TT

B

 .........780.........790.........800.........810.........820.........830.........840
Sequence RNYGDMDIYITASGIDDQALEDDRLRKYYLGKYLQEVLKAYLIDKVRIKGYYAFKLAEEKSKPRFGFFTS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
S






S
SS

TT



SB

TTS



SB
T
 .........850.........860.
Sequence DFKAKSSIQFYNKVISSRGFP
Predicted secondary structure








SS confidence




















Known secondary structure (DSSP) T

B
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D