Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5vakA_

Fold library idPDB HeaderMoleculeTitle
c5vakA_1.70PDB header: signaling proteinChain: A: PDB Molecule: beta-klotho;


Added to library: Sat Feb 3 08:23:53 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FSGDGRAIWSFLYDTFPKNFFWGIGTGALQVEGSWKKDGKGPSIWDHFIHTHLKGSSDSYIFLEKDLSAL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
TTGGGGGG




B
STT





TTGGG


B


TT
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DFIGVSFYQFSISWPRLFPDGIVTVANAKGLQYYSTLLDALVLRNIEPIVTLYHWDLPLALQEKYGGWKN
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T
S

STTSSSSS

TT
SS

B
GGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DTIIDIFNDYATYCFQMFGDRVKYWITIHNPYLVAWHGYGTGMHAPGEKGNLAAVYTVGHNLIKAHSKVW
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTTT


TB

STT

BS
 .........220.........230.........240.........250.........260.........270.........280
Sequence HNYNTHFRPHQKGWLSITLGSHWIEPNRSENTMDIFKCQQSMVSVLGWFANPIHGDGDYPEGMRKKLFSV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T




SSTT
TSSSS

TTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LPIFSEAEKHEMRGTADFFAFSFGPNNFKPLNTMAKMGQNVSLNLREALNWIKLEYNNPRILIAENGWFT
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S



TT

SSSGGGTSSGGGS

TTS

TTS




 .........360.........370.........380.........390.........400.........410.........420
Sequence DSRVKTEDTTAIYMMKNFLSQVLQAIRLDEIRVFGYTAWSLLDGFEWQDAYTIRRGLFYVDFNSKQKERK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT

S





SB



GGGTTS

S

TTSTT


 .........430.........
Sequence PKSSAHYYKQIIRENGFSL
Predicted secondary structure





SS confidence


















Known secondary structure (DSSP)
TBS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D