Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5vakA_

Fold library idPDB HeaderMoleculeTitle
c5vakA_1.70PDB header: signaling proteinChain: A: PDB Molecule: beta-klotho;


Added to library: Sat Feb 3 08:23:53 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FSGDGRAIWSFLYDTFPKNFFWGIGTGALQVEGSWKKDGKGPSIWDHFIHTHLKGSSDSYIFLEKDLSAL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
TTGGGGGG




B
STT





TTGGG


B


TT
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DFIGVSFYQFSISWPRLFPDGIVTVANAKGLQYYSTLLDALVLRNIEPIVTLYHWDLPLALQEKYGGWKN
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T
S

STTSSSSS

TT
SS

B
GGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DTIIDIFNDYATYCFQMFGDRVKYWITIHNPYLVAWHGYGTGMHAPGEKGNLAAVYTVGHNLIKAHSKVW
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTTT


TB

STT

BS
 .........220.........230.........240.........250.........260.........270.........280
Sequence HNYNTHFRPHQKGWLSITLGSHWIEPNRSENTMDIFKCQQSMVSVLGWFANPIHGDGDYPEGMRKKLFSV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T




SSTT
TSSSS

TTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LPIFSEAEKHEMRGTADFFAFSFGPNNFKPLNTMAKMGQNVSLNLREALNWIKLEYNNPRILIAENGWFT
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S



TT

SSSGGGTSSGGGS

TTS

TTS




 .........360.........370.........380.........390.........400.........410.........420
Sequence DSRVKTEDTTAIYMMKNFLSQVLQAIRLDEIRVFGYTAWSLLDGFEWQDAYTIRRGLFYVDFNSKQKERK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT

S





SB



GGGTTS

S

TTSTT


 .........430.........
Sequence PKSSAHYYKQIIRENGFSL
Predicted secondary structure





SS confidence


















Known secondary structure (DSSP)
TBS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D