Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5vaeH_

Fold library idPDB HeaderMoleculeTitle
c5vaeH_3.11PDB header: cell adhesionChain: H: PDB Molecule: accessory sec system protein asp3;


Added to library: Sat Feb 24 08:25:06 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XKIQKHKEIYWGSTIIFHSPDQVYFENLIASGQTIHEWSSSWNYQGDRQVPSLPLLKRGRSYSLTRDXTS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)





S
B




TT



TTSSS
SSTT
S



S



SS
 .........80.........90.........100.........110.........120.........130....
Sequence YPSESVFLKLIFFDRYNREVSNHVERSDKXTFTYPEEAYSYKVQLLSAGVESFEFHCLRIEEIL
Predicted secondary structure






















SS confidence































































Known secondary structure (DSSP) STT



GGG
SSS

TT
S
SS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D