Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5v7pA_

Fold library idPDB HeaderMoleculeTitle
c5v7pA_2.30PDB header: transferaseChain: A: PDB Molecule: protein-s-isoprenylcysteine o-methyltransferase;


Added to library: Sat Jan 20 10:46:27 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LSPAGKISLQSFTGSSLVFFVICMFNHYYGITNLVVNTLIVFFYAVNVYFFLKFFYNEFAFAIAIRAAFL
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)

TT


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence GLVLVLGLYIKLVAPPNIQIFGGYMSVMALFHYSEFLAIAIVQPKQVSTDSFVINHSPQYTIAAVSSWVE
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) S
TTT
GGG

GGGG




 .........150.........160.........170.........180.........190.........200.........210
Sequence FFIETYFFPGLKEIHWLSNIGLCVCILGEVLRKTAILTAGSNFNHLVQCEKSSDHVLVTHGVYAWFRHPS
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
T
GGG

SS

SS

TT




ST
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence YVGWFYWSIGTQIILINPLCIPAYTLASWMFFKERIYIEESMLLSFFGQQYCDYQQQVGTGIPFIEGYKI
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TT
TTTS

SSTT


S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D