Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5v2sA_

Fold library idPDB HeaderMoleculeTitle
c5v2sA_3.60PDB header: viral proteinChain: A: PDB Molecule: envelope glycoprotein b;


Added to library: Sat May 19 08:26:13 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IKAENTDANFYVCPPPTGATVVQFEQPRRCPTRPEGQNYTEGIAVVFKENIAPYKFKATMYYKDVTVSQV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
B
S

SS





SSS


















S
 .........80.........90.........100.........110.........120.........130.........140
Sequence WFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRSTAKYVRNNLETTAFHRDDHETDMELKPANAATRT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
SS


TTTTTS
S

TTS
GGG









SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence SRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTS
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

S

S






TT

TT
S
BTT


B
B
TT
SSSSSGGGS
B
 .........220.........230.........240.........250.........260.........270.........280
Sequence YAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTMTKWQEVDEMLRSEYGGS
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S
TTTTT


B
TTT

B
S




SS





STT
 .........290.........300.........310.........320.........330.........340.........350
Sequence FRFSSDAISTTFTTNLTEYPLSRVDLGDCIGKDARDAMDRIFARRYNATHIKVGQPQYYLANGGFLIAYQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTTT
SS


GGGBSS
TTTT
SS
TTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence PLLSNTLAELYVREHLREQSRKPSVERIKTTSSIEFARLQFTYNHIQRHVNDMLGRVAIAWCELQNHELT
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) STTGGGTT



B




S

 .........430.........440.........450.........460.........470.........480.........490
Sequence LWNEARKLNPNAIASVTVGRRVSARMLGDVMAVSTCVPVAADNVIVQNSMRISSRPGACYSRPLVSFRYE
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SS
TT

GGG
SBSB
SSSTTSS

SS
 .........500.........510.........520.........530.........540.........550.........560
Sequence DQGPLVEGQLGENNELRLTRDAIEPCTVGHRRYFTFGGGYVYFEEYAYSHQLSRADITTVSTFIDLNITM
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTS


SSSBS





TT
TTTTGGGS












 .........570.........580.........590.........600.........610.........620.........630
Sequence LEDHEFVPLEVYTRHEIKDSGLLDYTEVQRRNQLHDLRFADIDTVIHAVMGIVGGVVSAVSGVSSFFGAL
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)









SS
TTSS

TTS
SS







 .........640.........650.........660.........670.........680.........690.........700
Sequence AVGLLVLAGLAAAFFAFRYVMRLQSNPMKALYPLTTKELEEGGDFDEAKLAEAREMIRYMALVSAMERTE
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) SS
S
GGG









 .....
Sequence HKAKK
Predicted secondary structure

SS confidence




Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D