Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5uz9A_

Fold library idPDB HeaderMoleculeTitle
c5uz9A_3.40PDB header: immune system/rnaChain: A: PDB Molecule: crispr-associated protein csy1;


Added to library: Sat Apr 29 08:15:31 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QELRQFIESFIQERLQGKLDKLQPDEDDKRQTLLATHRREAWLADAARRVGQLQLVTHTLKPIHPDARGS
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TTTTTS

TT
TTS
B
SBBSTTT
TT



 .........80.........90.........100.........110.........120.........130.........140
Sequence NLHSLPQAPGQPGLAGSHELGDRLVSDVVGNAAALDVFKFLSLQYQGKNLLNWLTEDSAEALQALSDNAE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
B








SS

STTS

S




B
S
GGGSTTSSS
TTS
TTTT


 .........150.........160.........170.........180.........190.........200.........210
Sequence QAREWRQAFIGITTVKGAPASHSLAKQLYFPLPGSGYHLLAPLFPTSLVHHVHALLREARFGDAAKAARE
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTTS

SS



TTS

B

B
SSS
B

B


B
SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence ARSRQESWPHGFSEYPNLAIQKFGGTKPQNISQLNNERRGENWLLPSLPPNWQRQNVNAPMRHSSVFEHD
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) T


S










STT
TTTSTT

GGGSS





TTSS






SSTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence FGRTPEVSRLTRTLQRFLAKTVHNNLAIRQRRAQLVAQICDEALQYAARLRELEPGWSATPGCQLHDAEQ
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) T


TTSS

GGGTTTTT






S

SSTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence LWLDPLRAQTDETFLQRRLRGDWPAEVGNRFANWLNRAVSSDSQILGSPEAAQWSQELSKELTMFKEILE
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) S




TT

STTTTTSSS


TTS


STTTSSTGG
 ....
Sequence DERD
Predicted secondary structure

SS confidence



Known secondary structure (DSSP) GS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D