Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5uz8A_

Fold library idPDB HeaderMoleculeTitle
c5uz8A_1.85PDB header: cell adhesionChain: A: PDB Molecule: cadherin-23;


Added to library: Sat Mar 3 08:58:54 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIAN
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)



SSTT


TT

TT



S
GGGG

SSSSS
TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence RTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTAT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S


TTT
S

SSS



S



SSS
TT

TT


 .........150.........160.........170.........180.........190.........200.........210
Sequence DADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

S
GGGG
S

TTT
TTT

S


TTT
SSTTS
GGG

 .........220.........230.........240.........250.........260.........270.........280
Sequence RVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGMEAFSVDMDSGLVTT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)






B
SSSTT

TT



B

S
GGGG

STTGGG
TTT
 .........290.........300.........310.......
Sequence QRPLQSYERFNLTVVATDGGEPPLWGTTMLLVEVIDV
Predicted secondary structure













SS confidence




































Known secondary structure (DSSP) SS


TT

SSSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D