Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5uz8A_

Fold library idPDB HeaderMoleculeTitle
c5uz8A_1.85PDB header: cell adhesionChain: A: PDB Molecule: cadherin-23;


Added to library: Sat Mar 3 08:58:54 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIAN
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)



SSTT


TT

TT



S
GGGG

SSSSS
TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence RTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTAT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S


TTT
S

SSS



S



SSS
TT

TT


 .........150.........160.........170.........180.........190.........200.........210
Sequence DADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

S
GGGG
S

TTT
TTT

S


TTT
SSTTS
GGG

 .........220.........230.........240.........250.........260.........270.........280
Sequence RVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGMEAFSVDMDSGLVTT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)






B
SSSTT

TT



B

S
GGGG

STTGGG
TTT
 .........290.........300.........310.......
Sequence QRPLQSYERFNLTVVATDGGEPPLWGTTMLLVEVIDV
Predicted secondary structure













SS confidence




































Known secondary structure (DSSP) SS


TT

SSSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D