Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5uxmA_

Fold library idPDB HeaderMoleculeTitle
c5uxmA_1.54PDB header: transferaseChain: A: PDB Molecule: phospho-2-dehydro-3-deoxyheptonate aldolase;


Added to library: Sat Mar 3 08:30:47 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SWSPESWRAKPIQQQPEYPDAAHLARVEQTLAGYPPLVFAGEARELRRQFAEVTAGRAFLLQGGDCAESF
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)


TTGGGGS


S



S
TS

SS
TTS

SS

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence AEFSAAKIRDTFKVLLQMAVVMTFAAGCPVVKVGRMAGQFAKPRSSGDETQNGVTLPAYRGDIVNGIGFD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) T






SS





S
STT



TTT

SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EKSRVPDPERLLQAYHQSTASLNLLRAFAQGGFADLHQVHRWNLDFIANSALAERYQQLADRIDETLAFM
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) S

TTTT
GGGGGGGS
TTS
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence RACGLDSAPQLRETSFFTAHEALLLNYEEALTRRDSLTGEWYDCSAHMLWIGDRTRQIDGAHVEMLRGVG
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TT



GGGT






T
TTT

TT
S
TTS

TTST

 .........290.........300.........310.........320.........330.........340.........350
Sequence NPIGVKVGPSMDSEELIRLIDILNPDNDPGRLNLIVRMGADKVGDHLPRLIQAIQREGRQVLWSSDPMHG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S

TT


TT

TTS


TTTTT




STT
 .........360.........370.........380.........390.........400.........410.........420
Sequence NTIKASSGYKTRDFARVLAEVRQFFEVHQAEGSYAGGIHIEMTGQNVTECIGGSRPITEDGLSDRYHTHC
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S
TT

BT



B

SS


SBSSSS




GGGGGGGTTS
 .........430.........440......
Sequence DPRLNADQSLELAFLIAETLKQVRRW
Predicted secondary structure






SS confidence

























Known secondary structure (DSSP)


B
T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D