Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5uxmA_

Fold library idPDB HeaderMoleculeTitle
c5uxmA_1.54PDB header: transferaseChain: A: PDB Molecule: phospho-2-dehydro-3-deoxyheptonate aldolase;


Added to library: Sat Mar 3 08:30:47 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SWSPESWRAKPIQQQPEYPDAAHLARVEQTLAGYPPLVFAGEARELRRQFAEVTAGRAFLLQGGDCAESF
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)


TTGGGGS


S



S
TS

SS
TTS

SS

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence AEFSAAKIRDTFKVLLQMAVVMTFAAGCPVVKVGRMAGQFAKPRSSGDETQNGVTLPAYRGDIVNGIGFD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) T






SS





S
STT



TTT

SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EKSRVPDPERLLQAYHQSTASLNLLRAFAQGGFADLHQVHRWNLDFIANSALAERYQQLADRIDETLAFM
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) S

TTTT
GGGGGGGS
TTS
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence RACGLDSAPQLRETSFFTAHEALLLNYEEALTRRDSLTGEWYDCSAHMLWIGDRTRQIDGAHVEMLRGVG
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TT



GGGT






T
TTT

TT
S
TTS

TTST

 .........290.........300.........310.........320.........330.........340.........350
Sequence NPIGVKVGPSMDSEELIRLIDILNPDNDPGRLNLIVRMGADKVGDHLPRLIQAIQREGRQVLWSSDPMHG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S

TT


TT

TTS


TTTTT




STT
 .........360.........370.........380.........390.........400.........410.........420
Sequence NTIKASSGYKTRDFARVLAEVRQFFEVHQAEGSYAGGIHIEMTGQNVTECIGGSRPITEDGLSDRYHTHC
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S
TT

BT



B

SS


SBSSSS




GGGGGGGTTS
 .........430.........440......
Sequence DPRLNADQSLELAFLIAETLKQVRRW
Predicted secondary structure






SS confidence

























Known secondary structure (DSSP)


B
T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D