Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ux5C_

Fold library idPDB HeaderMoleculeTitle
c5ux5C_2.70PDB header: oxidoreductase/transferaseChain: C: PDB Molecule: bifunctional protein proline utilization a (puta);


Added to library: Sat Apr 29 08:47:12 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LMSYINRDLENLQERIIARANEWLARLRQMVSHLVLDAEGKALNKLLDESKAKGYRLNVNLLGEAVLGDG
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)

TT

ST

TT
SSSTT
S


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence EANNRLTRTMELLKNPRVDYVSIKATSVVAQLNPWDIDGNTELLKERLRPLYRLALQRSPHPFINLDMEE
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) STT

STT

TT
SSSS



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence YKDLHVTIRLFEELLMEEEFLGLEAGIVLQAYLPDSFQALQQLADFAKRRAAAGGAKIKIRLVKGANLSM
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTSGGGTT

TTSTTTT




S
 .........220.........230.........240.........250.........260.........270.........280
Sequence EKVDAELHGWYPAPYATKEEVDANFLRMMDYILRPEHENVRVGIASHNLFSVASAYELSVERGVETQLDV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T


SS
SSSSGGGTT
S
T
GGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence EMLQGMAPAQAEAVRQAVGTVILYTPVVHAEDFDVAVSYLVRRLEENLTEQEARFRESVAQRWKVAEDSR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTT
S

GGGT

TTTTS

S
G
 .........360.........370.........380.........390.........400.........410.........420
Sequence RLSTPETFNASDSDPALLSTLEWARTLEDPQPKWRLITDVEEVDKTVAGLLKSPRLDIAERTALLQRAAD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) GGS



SS




TTST









B

S



 .........430.........440.........450.........460.........470.........480.........490
Sequence ELENIRQDLLGVMTHEAGKTIAEADPEVSEAIDFARYYARCANALNTPGHSKFTPHNLVVVASPWNFPVA
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTS


TT
SSS
S

SSSTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence IPLGGVFASLAAGAKAILKPAPEVRRCAEVALTALRKAGIGEDLVQLMHTDEADAGRRLMSHPDVDAIIL
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) T


GGGTT

TTT

B
SS
TT

 .........570.........580.........590.........600.........610.........620.........630
Sequence TGASETASLFRGWKPEMNIHAETSGKNAIIVTPSADPDLAVADVYKSAFGHAGQKCSAASLVILVGDVGR
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S
TSTT






TTS
GGGG
STT
S

TT
 .........640.........650.........660.........670.........680.........690.........700
Sequence FTDQLIDATRTLRVGYGHELSTTMNGLISPPGEKLHRGLTTLETGESWLVKPEKLNDEGTLWSPGIRDNV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

B

TTSTT
SB


SSS




TT



B
STTS

B

S
 .........710.........720.........730.........740.........750.........760.........770
Sequence RPGSWFHTHECFGPVLGIMHAESLEQAIEWQNSTGFGLTGGIHSLDEDEVELWKEKVEVGNAYINRGITG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TTS



SSSSTSSS
S



SSS
S

 .........780.........790.........800.........810.........820.........830.........840
Sequence AIVQRQPFGGWKNSSVGVGAKAGGPNYVAQLGTWEDIESDVPSVSLPPAYRELANTEFLKRAAALDEIAW
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)

TTTS
B

TTSS


BTSTTSGGGS












S
 .........850.........860.........870.........880.........890.........900.........910
Sequence RTEFGVEQDFTGLRCESNVFRYRPLETLYVVGDDEEQFNRLKLAALRTGTELRKLETHEWFPPHSRIRAI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTT

B
SS

SS
SS





TT



TT

 .........920.........930.........940.........950.........960..
Sequence GDAPVPTTIYEWAALNGSVVIDGPVLADGRRELLHFLKEQAVSTTNHRFGYI
Predicted secondary structure























SS confidence



















































Known secondary structure (DSSP) SSS


T

S


S
GGGG

BTTB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D