Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5uv4A_

Fold library idPDB HeaderMoleculeTitle
c5uv4A_2.30PDB header: transferaseChain: A: PDB Molecule: putative leucine-rich repeat protein kinase family protein;


Added to library: Sat Apr 29 09:16:06 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DLHLFDNSVVFTAEELSCAPAEIIGRSCHGTSYKATLDNGYMLTVKWLKEGFAKSKKEFSREIKKLGSVR
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SSSSS


TS

SS
TTS

TTTB

T

 .........80.........90.........100.........110.........120.........130.........140
Sequence HPNLVPLRGYYWGPKEHERIMISDYADATSLSTYLSEFDERNLPPLSAGQRLNIAIDIARCLDYLHNERV
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)
TTB


SSTT




TTTSS




TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence IPHGNIKSSNVLIQNSTPSALVTDYSLHRLMTPIGMAEQVLNAGALGYSPPEFSSTSKPCPSLKSDVYAF
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)






GGG
SSSSS
S

GGGGB
T


GGGTT
SS



 .........220.........230.........240.........250.........260.........270.........280
Sequence GVILLELLTGKIAGEIICMVDLTDWVRMLDLEERVSECYDRHIAPQALDGMLRIALRCIRSASERPEVRT
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


TT






TT
GGGGS
TT


TS
TTT


 .........290
Sequence VFEDLLSLSS
Predicted secondary structure
SS confidence









Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D