Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5uuoB_

Fold library idPDB HeaderMoleculeTitle
c5uuoB_1.25PDB header: transferaseChain: B: PDB Molecule: glutathione s-transferase-like protein;


Added to library: Sat Mar 3 08:33:39 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YVPPKVWKWDKANGGAFASVNRPVAGPTSERELPVGKHPFQVYSLGTPNGQKATIMLEELLQLGFSEAEY
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)



SS



S

SGGGTTT

SS
S
SB






SSS
SSTT
GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence DAWLIKIFEGDQFTSGFVDINPNSKIPAMVDRSGPEPFRVFESGAILMHLAEKFGVFLPTSGPARAECLS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

GGGTGGGB
TT

S

SSSS
ST
SS
SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence WLFWQVGSAPFIGGGFGHFYNYAPIKIEYAIDRYAMETKRLFDVANRRLAESRYLAGDEYTIADLATYTW
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTTTSSS

TT
SBTTBSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence FGNIYRGEAYGEAATFLSMHEYEHVGRWVGEIDARPGVLRGRLVNSSKGLAERHDASDFDALPPESLQAI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT
SSTTTTGGG
T
TTBT
TTSBS
BSSGGGGGGS
GGGGS

 ....
Sequence VKGF
Predicted secondary structure

SS confidence



Known secondary structure (DSSP)




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D