Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5utsC_

Fold library idPDB HeaderMoleculeTitle
c5utsC_2.30PDB header: lyaseChain: C: PDB Molecule: c-s lyase egt2;


Added to library: Sat Feb 24 08:44:24 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GPLPFGNSLLKEFVLDPAYRNLNHGSFGTIPSAIQQKLRSYQTAAEARPCPFLRYQTPVLLDESRAAVAN
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)




SGGGGGGB


TTSB
S



BS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LLKVPVETVVFVANATXGVNTVLRNIVWSADGKDEILYFDTIYGACGKTIDYVIEDKRGIVSSRCIPLIY
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TS
GGGS




TTS
TTS
TTTS


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence PAEDDDVVAAFRDAIKKSREEGKRPRLAVIDVVSSXPGVRFPFEDIVKICKEEEIISCVDGAQGIGXVDL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S

TT
SB
SSS

B

TT

TTTTTTS

 .........220.........230.........240.........250.........260.........270.........280
Sequence KITETDPDFLISNCHWLFTPRGCAVFYVPVRNQHLIRSTLPTSHGFVPQNKSAFVSNFEFVGTVDNSPFF
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)


S






SS


GGGGGG

S
SS

TT






TT
SS



 .........290.........300.........310.........320.........330.........340.........350
Sequence CVKDAIKWREEVLGGEERIXEYXTKLAREGGQKVAEILGTRVLENSTGTLIRCAXVNIALPFVVGEDPKA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TS

TS
B


TTS
S

SS
S



SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence PVKLTEKEEKDVEGLYEIPHEEANXAFKWXYNVLQDEFNTFVPXTFHRRRFWARLSAQVYLEXSDFEWAG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)




TTT


GGGTS
B



SS


TT

 .........430.....
Sequence KTLKELCERVAKGEY
Predicted secondary structure



SS confidence














Known secondary structure (DSSP) TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D