Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5utsC_

Fold library idPDB HeaderMoleculeTitle
c5utsC_2.30PDB header: lyaseChain: C: PDB Molecule: c-s lyase egt2;


Added to library: Sat Feb 24 08:44:24 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GPLPFGNSLLKEFVLDPAYRNLNHGSFGTIPSAIQQKLRSYQTAAEARPCPFLRYQTPVLLDESRAAVAN
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)




SGGGGGGB


TTSB
S



BS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LLKVPVETVVFVANATXGVNTVLRNIVWSADGKDEILYFDTIYGACGKTIDYVIEDKRGIVSSRCIPLIY
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TS
GGGS




TTS
TTS
TTTS


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence PAEDDDVVAAFRDAIKKSREEGKRPRLAVIDVVSSXPGVRFPFEDIVKICKEEEIISCVDGAQGIGXVDL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S

TT
SB
SSS

B

TT

TTTTTTS

 .........220.........230.........240.........250.........260.........270.........280
Sequence KITETDPDFLISNCHWLFTPRGCAVFYVPVRNQHLIRSTLPTSHGFVPQNKSAFVSNFEFVGTVDNSPFF
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)


S






SS


GGGGGG

S
SS

TT






TT
SS



 .........290.........300.........310.........320.........330.........340.........350
Sequence CVKDAIKWREEVLGGEERIXEYXTKLAREGGQKVAEILGTRVLENSTGTLIRCAXVNIALPFVVGEDPKA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TS

TS
B


TTS
S

SS
S



SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence PVKLTEKEEKDVEGLYEIPHEEANXAFKWXYNVLQDEFNTFVPXTFHRRRFWARLSAQVYLEXSDFEWAG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)




TTT


GGGTS
B



SS


TT

 .........430.....
Sequence KTLKELCERVAKGEY
Predicted secondary structure



SS confidence














Known secondary structure (DSSP) TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D