Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5us6L_

Fold library idPDB HeaderMoleculeTitle
c5us6L_2.61PDB header: oxidoreductaseChain: L: PDB Molecule: 4-hydroxy-tetrahydrodipicolinate reductase;


Added to library: Sat Feb 24 08:31:32 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MVRIAVAGAAGRMGRNLVKAAHHNAKVAAGSERPDDLAKQIDQFDVIIDFTAPASTLNNLALCQQYGKSI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

TT
SST










GGGGTTT
S
S
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence VIGTTEEQREQIDLVVPVVMAPNYSVGVNLVFKLLEKAAKVMGDYCDIEIVEAHHRHKVDAPSGTAIGMG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)





S


TTTS
TT

SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EAIAGAMGNKLSDVAVYAREGITGERTKDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTFAN
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT





S


S

SS

TT


SS

ST
 .........220.........230.......
Sequence GAVKAAVWLHEKPAGFYTMTDVLGLND
Predicted secondary structure









SS confidence


























Known secondary structure (DSSP) TT

S
T



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D