Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5uqqD_

Fold library idPDB HeaderMoleculeTitle
c5uqqD_2.30PDB header: transferaseChain: D: PDB Molecule: 2-methylcitrate synthase, mitochondrial;


Added to library: Sat Feb 17 08:25:13 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AEPDLKTALKAVIPAKRELFKQVKERSDEVIGEVKVANVIGGMRGLKSMLWEGSVLDPEEGIRFHGKTIK
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)



TTT






TTTTT






STTTTTB
 .........80.........90.........100.........110.........120.........130.........140
Sequence DCQKELPKGTSGTEMLPEAMFWLLLTGQVPSTNQVRAFSRELAEQSHLPQHILDLIKSFPRSMHPMTQLS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S
B
SS
SSB
SS


T



S
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence IAVAALNTESKFAKAYEKGLSKADYWEPTFDDSISLLAKIPRVAALVFRPDEVDQVGTQALDASQDWSYN
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) GGGG



GGGT
TT




TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence FAELLGKGGKENQDFHDLLRLYLALHGDHEGGNVSAHATHLVGSALSDPFLSYSAGLLGLAGPLHGLAAQ
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT

SGGGTS


S
STT

TS
 .........290.........300.........310.........320.........330.........340.........350
Sequence EVLRWILAMQDKIGTKFTDDDVRNYLWDTLKSGRVVPGYGHGVLRKPDPRFQALMDFAATRPDVLANPVF
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SS

TT


TTB

SS

S

T

 .........360.........370.........380.........390.........400.........410.........420
Sequence QLVKKNSEIAPAVLTEHGKTKNPHPNVDAASGVLFYHYGFQQPLYYTVTFGVSRALGPLVQLIWDRALGL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)

SSS

B
GGGTTT


GGGTTT
 .........430....
Sequence PIERPKSINLLGLK
Predicted secondary structure













SS confidence













Known secondary structure (DSSP)










Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D