Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5uqiA_

Fold library idPDB HeaderMoleculeTitle
c5uqiA_1.62PDB header: isomeraseChain: A: PDB Molecule: phosphosugar isomerase;


Added to library: Sat Feb 24 08:31:12 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MNNTDLIHLIKHFMHNELKAVEEVIDSPLSEFANLIKVLQSCQGKVVFIGVGKSGIIARKLAATFASTGT
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)

TS

TT
SS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence PSFFVHGTEAVHGDLGMVAKDDVVILISNSGETAEILATLPSLKKMGNYLISFTRSHHSSLAISCDLSVE
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
TTGGGG

TT

SSS

TTT

S
TTSSS
 .........150.........160.........170.........180........
Sequence IPVKSEADNLGLAPSCSSTVVLVVGDAVALALSELKKFTRADFGLYHP
Predicted secondary structure




















SS confidence















































Known secondary structure (DSSP)





SSTTS
SSSTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D