Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5unlA_

Fold library idPDB HeaderMoleculeTitle
c5unlA_1.65PDB header: oxidoreductaseChain: A: PDB Molecule: 3-ketoacyl-acp reductase;


Added to library: Thu Feb 23 10:41:43 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TASDLLKPYDGLRVLVTGGASGIGLAIADAFAECGARVHVCDASQAAIAALADRPSRAAIGATLADVSDR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TS

TT
TTTTSTT
S
TTTT
TT





TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AAVERVFADVAATLGGLDVLVNNAGIAGPTGGIDEIDPAQWEQTVAINLNAQFEFARRAVPLLRESKHGG
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TSS
S







S
TTTS
TTT
TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence AIIALSSVAGRLGYAYRTPYAATKWAVVGLVKSLAIELGPLGIRVNAIQPGIVRGPRIRRVIEARAQQLG
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

GGGTS

TT
GGGT

SB
ST
 .........220.........230.........240.........250.........260....
Sequence IGYDEMEQRYLERISLRRMTEPAEIAATALFLCSPGGHGITGQAISVCGNVEVL
Predicted secondary structure
























SS confidence





















































Known secondary structure (DSSP)

TBTTSS
B
TSTTTTT

S
SS
B



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D