Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5um0A_

Fold library idPDB HeaderMoleculeTitle
c5um0A_1.85PDB header: isomeraseChain: A: PDB Molecule: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase;


Added to library: Thu Feb 23 10:20:18 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HHHMELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKENGYEFDIAFTSVLTRAIKTCNIV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

S


BTB

TTS


B
TT


S
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LEESDQLFVPQIKTWRLNERHYGRLQGLDKKQTAEKYGDEQVRIWRRSYDTLPPLLDKDDAFSAHKDRRY
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT
TTS

GGGS



GGGTTSB
S
SS






TTSTT
GGG
GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence AHLPADVVPDGENLKVTLERVLPFWEDQIAPAILSGKRVLVAAHGNSLRALAKHIEGISDEDIMGLEIPT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTS
GGGS
S


TTT


T

TTGGGG



T
 .........220.........230
Sequence GQPLVYKLDDNLKVIEKFYL
Predicted secondary structure






SS confidence



















Known secondary structure (DSSP) T


TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D