Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ujeA_

Fold library idPDB HeaderMoleculeTitle
c5ujeA_2.50PDB header: gene regulationChain: A: PDB Molecule: sbni protein;


Added to library: Sat Jan 27 08:20:03 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XNHIHEHLKLVPVDKIDLHETFEPLRLEKTKSSIEADDFIRHPILVTAXQHGRYXVIDGVHRYTSLKALG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

TGGG
SB


TSS

STT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence CKKVPVQEIHETQYSISTWQHKVPFGVWWETLQQEHRLPWTTETRQEAPFITXCHGDTEQYLYTKDLGEA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
S
TTT


T



B



SS

STT

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence HFQVWEKVVASYSGCCSVERIAQGTYPCLSQQDVLXKYQPLSYKEIEAVVHKGETVPAGVTRFNISGRCL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTTBTTB


TTT




SS



TT

B
TTS
S


 .........220.........230.........240
Sequence NLQVPLALLKQDDDVEQLRNWKQFLADKFA
Predicted secondary structure








SS confidence





























Known secondary structure (DSSP)


T


TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D