Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ujdB_

Fold library idPDB HeaderMoleculeTitle
c5ujdB_2.10PDB header: gene regulationChain: B: PDB Molecule: siderophore biosynthesis protein sbni;


Added to library: Sat Jan 27 08:19:43 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKQIYDTLQLIPVDKIDLHEAFEPSRLEKTKESIAKEQHLRHPVLVVKTLFGRYMVIDGVHRFMSLKALG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

GGG
SB


TSS

STT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence CEVIPVQVIQRTQYSIGSWHHKIPNGAWCEGLTDEELLPWTTEVRDETPFITMCDQQTEHYLYVADLTVD
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
S

GGGTTGGG
S


S

B



SS

S
SS

GGG
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KLDIWKKVVNSYSASCNVERVPHSACLCLDSNDILMKYQPLQIGEIEAVVQRGQTVPAGVTRFNIAGRCL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTTS

TTS




TT




TT

B
TT
SS


 .........220.........230.........240.........250....
Sequence NLQVPLHLLKNSNLGNQEQWHTFLQKKIESMRCYTEKIYLIEAE
Predicted secondary structure












SS confidence











































Known secondary structure (DSSP)


GGGSS


TT




S








Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D