Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5uflB_

Fold library idPDB HeaderMoleculeTitle
c5uflB_3.00PDB header: signaling proteinChain: B: PDB Molecule: protein cip2a;


Added to library: Thu Feb 23 10:10:17 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ACLKSLLLTVSQYKAANATQLLRHLEVRLFTSNQILTSECLSCLVELLEDPSASLILSIIGLLSQDIETR
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
T





TTS

STT




TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DCLQNTLNSVLAGVVCDSVFLQCIQLLQKLTYNVKIFYSGANIDELITFLIDHIQSSELKMPCLGLLANL
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)




TTS



STTTT



 .........150.........160.........170.........180.........190.........200.........210
Sequence CRHNLSVQTHIKTLSKSFYRTLITLLAHSSLTVVVFALSILSSLTLNEEVGEKLFHARNIHQTFQLIFNI
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TT
TT


GGG
SSSSSSTTSTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LINGDGTLTRKYSVDLLMDLLKNPKIADYLTRYEHFSSCLHQVLGLLNGKDPDSSSKVLELLLAFCSVTQ
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) S
SSTSS
TTGGGS

TS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LRHMLTQMMFELEPTVALLRWLSQPLDNCSVLALELFKEIFEDVIDAANCSSADRFVTLLLPTILDQLQF
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)


SS



TTS
TTSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence TEQNLDEALTRKKCERIAKAIEVLLTLCGDDTLKMHIAKILTTVKCTTLIEQQFTYGKIDLGFGTKVADS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)


S

TTSS
TSS
SSSS

S
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence ELCKLAADVILKTLDLINKLKPLVPGMEVSFYKILQDPRLITPLAFALTSDNREQVQSGLRILLEAAPLP
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTTSTTT
GGGT
S
TTST
 .........500.........510.
Sequence DFPALVLGESIAANNAYRQQE
Predicted secondary structure








SS confidence




















Known secondary structure (DSSP) T




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D