Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ue8B_

Fold library idPDB HeaderMoleculeTitle
c5ue8B_3.35PDB header: exocytosisChain: B: PDB Molecule: protein unc-13 homolog a;


Added to library: Thu Feb 23 10:17:46 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NEELKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

S
TTS






SS

TTT


SGGG
TTT


TTTGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence LNADCLQRAAEKSSDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFAVTKSAHTQQMKAVKQSVLDGTSK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

S




TT

T
SSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence WSAKISITVVCAQGLQSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFNSSDRIKVRVWDEDDFLGQT
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)


S




TT




S
SS



S


 .........220.........230.........240.........250.........260.........270.........280
Sequence IIEVRTLSGEMDVWYNLDKRVSGAIRLHISVEIVAPYHVQYTCLHENLFHFVTDVQNNGVVKIPDAKGDD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) GGG

S
B








TTTTSTT







STT
 .........290.........300.........310.........320.........330.........340.........350
Sequence AWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTVSASDRF
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) STT

S
STTT

GGG
SSTTTTSS



S
 .........360.........370.........380.........390.........400.........410.........420
Sequence AASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRAS
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) T
SS
TTS
SS
TT



SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence QVVKDCVKACLNSTYEYIFNNCHELYGREYQQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQE
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) SS



S
SS

T

SSTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence LNVGKISAEVMWSLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVAELPTFKDRVPEYPAWFE
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)



S
TTTSTTTSSS

S
 .........570.........580.........590.........600.........610.........620.........630
Sequence PFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGH
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) T


SSSS

S
STT



 .........640.........650.........660.........670.........680.........690.........700
Sequence YMRRFAKTISNVLLQYADIVSKDFASYCSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TSGGGTSSS
SSTTGGGS
 .........710.........720.........730.........740.........750.........760.........770
Sequence KELQVKLNNVLDELSHVFATSFQPHIEECVRQMGDILSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVL
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TT


S
 .........780.........790.........800.........810.........820.........830........
Sequence KRVLKELWKLVMNTMERTIVTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYT
Predicted secondary structure














SS confidence



































































Known secondary structure (DSSP)


TTTTS

T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D