Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5udmA_

Fold library idPDB HeaderMoleculeTitle
c5udmA_2.64PDB header: hydrolaseChain: A: PDB Molecule: phage-associated cell wall hydrolase;


Added to library: Sat Dec 30 08:25:31 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ATVSEVISYWRGLADTLAWGWQCADVTNGTTTNFFGVTLWGNAIDLLDSAKAQGLEVIYDAPGINPKAGD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)







SB
SS



S
GGGTT

BTTB


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LFVXFTYGHPYGHTGIIIADSDGYTIQTIEQGGPARYVTRAFSDGDGYIVGWIRPPYSDTRKLKDEVGTF
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT
TT

S


SS




SB
SS






 .........150.........160.........170.........180.........190.........200.........210
Sequence EVXVPALNVRREPSLNGEIVACYQYGXTGTYDSVYVGDGYIWVSYVGASGXRNYXAVGDADGDYNVNPYC
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
SSSSSSTT

TT
TT
TTSSTTS
 .....
Sequence KFYLE
Predicted secondary structure
SS confidence




Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D