Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ud6B_

Fold library idPDB HeaderMoleculeTitle
c5ud6B_2.40PDB header: lyaseChain: B: PDB Molecule: dihydrodipicolinate synthase;


Added to library: Sat Dec 30 09:46:15 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KHFFGRVITALVTPFKLTGVEVDYGVAESLAAHLAENGSDAIIVAGTTGESATLTWSEEYELFRVVKSAV
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

TT
S



B
TTSSSB
TTT
SSSGGGTGGGS
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence AGTKCRVIAGAGSNSTEEAIEATKKSAKLGLDGTLQVVPYYNKPPQQGIMAHFRAIANAAPDLPMMLYNI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTSS



SST
S


SS


STTS


 .........150.........160.........170.........180.........190.........200.........210
Sequence PGRTGINMTAETSIKLAEMCPNIVALEASGNLEQFARIRRATSPDFALYSGDDALTLPLLSLGGNGVVSV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S




TT


S

S
TTSB
SSGGGTT

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence ASHFIGPEIQRMIEHFVDLGNPEEAFRIHCRYMDLFEALFVMANPIPAKAALRLLGWPVGPTRLPLTDIT
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTS

TTSSSTTTT






TTS



 .........290........
Sequence ASAEQQLRQAMIAAGLLK
Predicted secondary structure




SS confidence

















Known secondary structure (DSSP) TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D