Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ucoB_

Fold library idPDB HeaderMoleculeTitle
c5ucoB_2.85PDB header: transferaseChain: B: PDB Molecule: 2,4,6-trihydroxybenzophenone synthase;


Added to library: Sat Dec 16 08:44:03 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KRASVLAIGTTNPEHFILQEDYPDFYFRNTNSEHMTELKEKFKRICVKSHIRKRHFYLTEEILKENQGIA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)



S
GGGTTT
TT
SS



S

TT
TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TYGAGSLDARQRILETEVPKLGQEAALKAIAEWGQPISKITHVVFATTSGFMMPGADYVITRLLGLNRTV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) STTS


S
GGG

SS


SS
TT

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence RRVMLYNQGCFAGGTALRVAKDLAENNEGARVLVVCAENTAMTFHAPNESHLDVIVGQAMFSDGAAALII
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S
GGGSTT

TTTT




SS
TTTB

 .........220.........230.........240.........250.........260.........270.........280
Sequence GACPDVASGERAVFNILSASQTIVPGSDGAITAHFYEMGMSYFLKEDVIPLFRDNIAAVMEEAFSPLGVS
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) S

GGGT




TT
TTSTT
TTGGGT

 .........290.........300.........310.........320.........330.........340.........350
Sequence DWNSLFYSIHPGGRGIIDGVAGNLGIKDENLVATRHVLGEYGNMGSACVMFILDELRKSSKVNGKPTTGD
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TTSS

SST

GGGG
B
GGGT
SBTTT
 .........360.........370.......
Sequence GKEFGCLIGLGPGLTVEAVVLQSVPIL
Predicted secondary structure








SS confidence


























Known secondary structure (DSSP) T
STTT
B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D