Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ucoB_

Fold library idPDB HeaderMoleculeTitle
c5ucoB_2.85PDB header: transferaseChain: B: PDB Molecule: 2,4,6-trihydroxybenzophenone synthase;


Added to library: Sat Dec 16 08:44:03 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KRASVLAIGTTNPEHFILQEDYPDFYFRNTNSEHMTELKEKFKRICVKSHIRKRHFYLTEEILKENQGIA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)



S
GGGTTT
TT
SS



S

TT
TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TYGAGSLDARQRILETEVPKLGQEAALKAIAEWGQPISKITHVVFATTSGFMMPGADYVITRLLGLNRTV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) STTS


S
GGG

SS


SS
TT

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence RRVMLYNQGCFAGGTALRVAKDLAENNEGARVLVVCAENTAMTFHAPNESHLDVIVGQAMFSDGAAALII
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S
GGGSTT

TTTT




SS
TTTB

 .........220.........230.........240.........250.........260.........270.........280
Sequence GACPDVASGERAVFNILSASQTIVPGSDGAITAHFYEMGMSYFLKEDVIPLFRDNIAAVMEEAFSPLGVS
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) S

GGGT




TT
TTSTT
TTGGGT

 .........290.........300.........310.........320.........330.........340.........350
Sequence DWNSLFYSIHPGGRGIIDGVAGNLGIKDENLVATRHVLGEYGNMGSACVMFILDELRKSSKVNGKPTTGD
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TTSS

SST

GGGG
B
GGGT
SBTTT
 .........360.........370.......
Sequence GKEFGCLIGLGPGLTVEAVVLQSVPIL
Predicted secondary structure








SS confidence


























Known secondary structure (DSSP) T
STTT
B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D