Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ubvB_

Fold library idPDB HeaderMoleculeTitle
c5ubvB_2.45PDB header: hydrolaseChain: B: PDB Molecule: atpase domain of i-aaa protease;


Added to library: Sat Dec 30 10:00:37 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NARFSDVHGCDEAKEELQELVEFLRNPEKFSNLGGKLPKGVLLVGPPGTGKTLLARAVAGEAGVPFFYMS
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


GGG

S

TT



S

TTSST

 .........80.........90.........100.........110.........120.........130.........140
Sequence GSEFDEIYVGVGAKRVRELFNAAKAKAPSIVFIDELDAIGGRRYVRQTLNQLLTEMDGFAQNSGVIILGA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTTS
SSS
TT
STB






TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence TNFPESLDKALTRPGRFDRHVHVSLPDVRGRIAILKHHAKKIKIGSDVNIAAIAARTSGLSGAELENIVN
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S
GGGB
TTTTSTTS




TTS
B
TT

T
TT

 .........220.........230........
Sequence QAAVHASKEKAKAVMQAHFEWAKDKVIM
Predicted secondary structure








SS confidence



























Known secondary structure (DSSP) TT
SSB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D