Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ubvB_

Fold library idPDB HeaderMoleculeTitle
c5ubvB_2.45PDB header: hydrolaseChain: B: PDB Molecule: atpase domain of i-aaa protease;


Added to library: Sat Dec 30 10:00:37 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NARFSDVHGCDEAKEELQELVEFLRNPEKFSNLGGKLPKGVLLVGPPGTGKTLLARAVAGEAGVPFFYMS
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


GGG

S

TT



S

TTSST

 .........80.........90.........100.........110.........120.........130.........140
Sequence GSEFDEIYVGVGAKRVRELFNAAKAKAPSIVFIDELDAIGGRRYVRQTLNQLLTEMDGFAQNSGVIILGA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTTS
SSS
TT
STB






TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence TNFPESLDKALTRPGRFDRHVHVSLPDVRGRIAILKHHAKKIKIGSDVNIAAIAARTSGLSGAELENIVN
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S
GGGB
TTTTSTTS




TTS
B
TT

T
TT

 .........220.........230........
Sequence QAAVHASKEKAKAVMQAHFEWAKDKVIM
Predicted secondary structure








SS confidence



























Known secondary structure (DSSP) TT
SSB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D