Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ub6B_

Fold library idPDB HeaderMoleculeTitle
c5ub6B_2.20PDB header: metal binding proteinChain: B: PDB Molecule: phosphate-binding protein;


Added to library: Sat Jan 13 08:18:22 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SSVLVLGRISDDPASHYEQLKPLLDYVVPRMREVGIRRGEILMAPDARQMSSYLRRGRVDWVSETTGAAM
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)


B
S
TGGGGGGT



BSSTTS

 .........80.........90.........100.........110.........120.........130.........140
Sequence LLEQRGSAHPLLMTERGGLRDFHTLFFVRRDSPIHSLSQLRGHTLALQNASSTSGYLLPMLELLRNGIAC
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTSTTBS
TT
S

SGGGGTT


TT
TTTTTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence DVLLSADDTPARGSAGYLMVGSKLNVAAFVHKHLIDVGALSNVDWDDERHMPPVFKRDFRIVHRTAPVPR
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SSTTS


TTS

STTSSSSTTTS
TT


S
 .........220.........230.........240.........250.........260.........270.........
Sequence AVEMVRTGMDPAVEQRLRVVLLQAASDPKAGPALKRFFDTTGFRPLDPTSRRRLQELSAGVQRVRDHVE
Predicted secondary structure


















SS confidence




































































Known secondary structure (DSSP) TT


GGGTTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D