Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ub6B_

Fold library idPDB HeaderMoleculeTitle
c5ub6B_2.20PDB header: metal binding proteinChain: B: PDB Molecule: phosphate-binding protein;


Added to library: Sat Jan 13 08:18:22 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SSVLVLGRISDDPASHYEQLKPLLDYVVPRMREVGIRRGEILMAPDARQMSSYLRRGRVDWVSETTGAAM
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)


B
S
TGGGGGGT



BSSTTS

 .........80.........90.........100.........110.........120.........130.........140
Sequence LLEQRGSAHPLLMTERGGLRDFHTLFFVRRDSPIHSLSQLRGHTLALQNASSTSGYLLPMLELLRNGIAC
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTSTTBS
TT
S

SGGGGTT


TT
TTTTTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence DVLLSADDTPARGSAGYLMVGSKLNVAAFVHKHLIDVGALSNVDWDDERHMPPVFKRDFRIVHRTAPVPR
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SSTTS


TTS

STTSSSSTTTS
TT


S
 .........220.........230.........240.........250.........260.........270.........
Sequence AVEMVRTGMDPAVEQRLRVVLLQAASDPKAGPALKRFFDTTGFRPLDPTSRRRLQELSAGVQRVRDHVE
Predicted secondary structure


















SS confidence




































































Known secondary structure (DSSP) TT


GGGTTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D