Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ua0B_

Fold library idPDB HeaderMoleculeTitle
c5ua0B_2.30PDB header: oxidoreductaseChain: B: PDB Molecule: 4-hydroxy-tetrahydrodipicolinate reductase 2,


Added to library: Sat Dec 16 08:25:36 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NGISIMVNGCSGKMGKAVIKAADSAGVNIVPTSFGSVEEAGQTVEVCGKEILVHGPTEREKVLSSVFEKY
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)


TTTSTT

S

TTTTT
TT
STT
 .........80.........90.........100.........110.........120.........130.........140
Sequence PELIVVDYTIPSAVNDNAELYGKVGVPFVMGTTGGDRTRLYKTVEESKIYAVISPQMGKQVVAFLAAMEI
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT


GGGT





S
T


S


 .........150.........160.........170.........180.........190.........200.........210
Sequence MSEQFPGAFAGYSLEVMESHQGTAKAVISCFQKLGVSYDMDQIQLIRDPKQQIEVVGVPEEHVSGHAFHL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) STTTTTT



TT



GGG

SSSSSS

S
 .........220.........230.........240.........250.........260.........270
Sequence YHLTSPDKTVSFEFQHNVCGRSIYAEGTVDAVLFLAKKIRSKAEKRIYNMIDVLREGNMR
Predicted secondary structure





















SS confidence



























































Known secondary structure (DSSP)
TTS


SSTT
S







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D